KEGG   Helicobacter bizzozeronii: HBZC1_15760Help
Entry
HBZC1_15760       CDS       T01540                                 

Definition
holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
hbi  Helicobacter bizzozeronii
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:hbi00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HBZC1_15760
Enzymes [BR:hbi01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     HBZC1_15760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1458649..1459179)
Genome map
AA seq 176 aa AA seqDB search
MLAPTFMELDVRGVIYGVHISLQTSQQLQESQEVFLHTTPIFREDTHLLFGFLQRSEQEI
FQRLIKISGVGPKVALAILSTYDPTEFETLIQVKDLKALQKVPSVGAKLAGKIMLDLAGY
FVENQPSPAPSAPLIQAVLALESLGFKKNEALKVCASLPPDLSTSERIKQALKQLK
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
ttgctcgcccccacttttatggagttagatgtgcgaggtgtgatctatggcgtgcatatc
agtttgcaaaccagccaacaactccaagagagtcaagaagtgtttttacacaccacgcct
attttccgcgaggatacgcatttgctttttggatttttacaacgctctgagcaagaaatt
ttccaacgcctcattaaaattagcggggtgggacccaaagtggctctagccattctctcc
acttacgacccgacagaatttgaaaccttgatccaagtcaaggacttaaaggctttgcag
aaggtccccagcgtgggcgcaaaactagcgggcaagatcatgctcgatttagccggctat
tttgtagaaaatcagcccagccccgcccctagcgcgcctttaatacaagcagtattggct
ttagagagtttgggctttaaaaagaatgaggctttaaaagtgtgcgcctccttgccacct
gatttgagcacaagcgagcgcatcaaacaagccctcaagcaacttaagtag

DBGET integrated database retrieval system