KEGG   Helicobacter bizzozeronii: HBZC1_15760Help
Entry
HBZC1_15760       CDS       T01540                                 

Definition
holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
hbi  Helicobacter bizzozeronii
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:hbi03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1458649..1459179)
Genome map
AA seq 176 aa AA seqDB search
MLAPTFMELDVRGVIYGVHISLQTSQQLQESQEVFLHTTPIFREDTHLLFGFLQRSEQEI
FQRLIKISGVGPKVALAILSTYDPTEFETLIQVKDLKALQKVPSVGAKLAGKIMLDLAGY
FVENQPSPAPSAPLIQAVLALESLGFKKNEALKVCASLPPDLSTSERIKQALKQLK
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
ttgctcgcccccacttttatggagttagatgtgcgaggtgtgatctatggcgtgcatatc
agtttgcaaaccagccaacaactccaagagagtcaagaagtgtttttacacaccacgcct
attttccgcgaggatacgcatttgctttttggatttttacaacgctctgagcaagaaatt
ttccaacgcctcattaaaattagcggggtgggacccaaagtggctctagccattctctcc
acttacgacccgacagaatttgaaaccttgatccaagtcaaggacttaaaggctttgcag
aaggtccccagcgtgggcgcaaaactagcgggcaagatcatgctcgatttagccggctat
tttgtagaaaatcagcccagccccgcccctagcgcgcctttaatacaagcagtattggct
ttagagagtttgggctttaaaaagaatgaggctttaaaagtgtgcgcctccttgccacct
gatttgagcacaagcgagcgcatcaaacaagccctcaagcaacttaagtag

DBGET integrated database retrieval system