KEGG   Helicobacter bizzozeronii: HBZC1_16250Help
Entry
HBZC1_16250       CDS       T01540                                 

Definition
(GenBank) pyruvate:ferredoxin oxidoreductase, alpha subunit
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
hbi  Helicobacter bizzozeronii
Pathway
hbi00010  Glycolysis / Gluconeogenesis
hbi00020  Citrate cycle (TCA cycle)
hbi00620  Pyruvate metabolism
hbi00640  Propanoate metabolism
hbi00650  Butanoate metabolism
hbi00680  Methane metabolism
hbi01100  Metabolic pathways
hbi01120  Microbial metabolism in diverse environments
hbi01130  Biosynthesis of antibiotics
hbi01200  Carbon metabolism
Module
hbi_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hbi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HBZC1_16250
   00020 Citrate cycle (TCA cycle)
    HBZC1_16250
   00620 Pyruvate metabolism
    HBZC1_16250
   00640 Propanoate metabolism
    HBZC1_16250
   00650 Butanoate metabolism
    HBZC1_16250
  Energy metabolism
   00680 Methane metabolism
    HBZC1_16250
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HBZC1_16250
Enzymes [BR:hbi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HBZC1_16250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C TPP_enzyme_N
Motif
Other DBs
NCBI-ProteinID: CCB80611
UniProt: F8KQF0
Position
complement(1513205..1514428)
Genome map
AA seq 407 aa AA seqDB search
MASNYAMNEVEAWDGCTASAHALRQAQVDVVAAYPITPSTPIIQNYGSFKDNGYIDGEFV
LVESEHAAMSACVGAAAAGGRVSTATSSQGFALMIEVLYQASGMRLPIVLNVANRALASP
LNIHCDHSDMYLGRDSGWINLCTCNPQEVYDFTLMAFKLAEHTEVRVPVMVHQDGFLSSH
TVQNVRPLSDEVAYEFVGDYVGVHPMLDFDRPVSYGAQAEEEWHFEHKAKLHHAIMHSKA
ILESVFSDFAKITGRRYHIVESFMAEDAEVVIFALGTTYESAIVAAKKARQKGIKAGVVT
THLLRPFPFEQISEVLKNAKALAIMDKSSPSGAMGAMFNELAASLYQAKGCKHPVLSNYI
YGLGGRDLTQADLDGIFEELVQDVQKGTLTHPTQQFIGLNGPKLSFF
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcttctaattatgcgatgaatgaagtagaagcatgggatggttgcaccgctagcgca
cacgctctaaggcaggcacaggtcgatgttgtggcggcctaccccatcaccccctccacg
cccattatccaaaattacggctcatttaaggacaatggctacatcgatggcgagtttgtg
ttagtcgagtccgaacatgccgccatgagcgcgtgcgtgggggcggctgctgctgggggg
cgggtgagcacagccactagctcgcaaggttttgccctgatgattgaagtgctctaccaa
gcctcaggaatgcgcttgcccatcgtgttgaatgtggctaaccgcgcgctggcttcgccc
ttgaatatccattgcgatcactccgatatgtatttggggcgtgatagcgggtggatcaat
ctatgcacttgcaacccccaagaggtctatgattttaccttgatggcttttaagctggct
gaacatacagaagtgcgcgtgccagtcatggtgcatcaagacgggtttttatcctcccac
accgtgcaaaatgtccgccccttgagcgatgaagtggcttatgaatttgtgggcgattat
gtgggcgtgcatcccatgcttgattttgatcgcccagtgagctatggcgcacaagcggag
gaagaatggcattttgagcataaagccaaactccaccacgctattatgcactccaaagcc
attttagagagcgtgtttagcgattttgccaagattacggggcggcgttaccacattgtg
gaatctttcatggctgaagatgcggaggtggtgatctttgctctgggcacgacctatgaa
tctgccattgtagctgccaagaaagccagacaaaagggcattaaagcaggcgtggtgacc
acgcatttactgcgccccttcccctttgagcagattagcgaggtgcttaaaaacgccaaa
gccttagccatcatggataaaagctccccctctggtgcgatgggcgcgatgtttaacgag
ctggccgctagtttgtatcaggcaaaagggtgtaagcaccccgtgctgagtaattacatc
tatgggctgggtgggcgcgacttgacccaagcggatttagatggcatttttgaggaattg
gttcaagatgtgcaaaaaggcacgctgacccaccccacccaacaattcatcggactcaat
ggtcctaaattgtctttcttttaa

DBGET integrated database retrieval system