KEGG   Helicobacter bizzozeronii: HBZC1_16250Help
Entry
HBZC1_16250       CDS       T01540                                 

Definition
pyruvate:ferredoxin oxidoreductase subunit alpha (EC:1.2.7.1)
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
hbi  Helicobacter bizzozeronii
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hbi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HBZC1_16250
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HBZC1_16250
   00020 Citrate cycle (TCA cycle)
    HBZC1_16250
   00620 Pyruvate metabolism
    HBZC1_16250
   00640 Propanoate metabolism
    HBZC1_16250
   00650 Butanoate metabolism
    HBZC1_16250
  Energy metabolism
   00680 Methane metabolism
    HBZC1_16250
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    HBZC1_16250
Enzymes [BR:hbi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     HBZC1_16250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1513205..1514428)
Genome map
AA seq 407 aa AA seqDB search
MASNYAMNEVEAWDGCTASAHALRQAQVDVVAAYPITPSTPIIQNYGSFKDNGYIDGEFV
LVESEHAAMSACVGAAAAGGRVSTATSSQGFALMIEVLYQASGMRLPIVLNVANRALASP
LNIHCDHSDMYLGRDSGWINLCTCNPQEVYDFTLMAFKLAEHTEVRVPVMVHQDGFLSSH
TVQNVRPLSDEVAYEFVGDYVGVHPMLDFDRPVSYGAQAEEEWHFEHKAKLHHAIMHSKA
ILESVFSDFAKITGRRYHIVESFMAEDAEVVIFALGTTYESAIVAAKKARQKGIKAGVVT
THLLRPFPFEQISEVLKNAKALAIMDKSSPSGAMGAMFNELAASLYQAKGCKHPVLSNYI
YGLGGRDLTQADLDGIFEELVQDVQKGTLTHPTQQFIGLNGPKLSFF
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcttctaattatgcgatgaatgaagtagaagcatgggatggttgcaccgctagcgca
cacgctctaaggcaggcacaggtcgatgttgtggcggcctaccccatcaccccctccacg
cccattatccaaaattacggctcatttaaggacaatggctacatcgatggcgagtttgtg
ttagtcgagtccgaacatgccgccatgagcgcgtgcgtgggggcggctgctgctgggggg
cgggtgagcacagccactagctcgcaaggttttgccctgatgattgaagtgctctaccaa
gcctcaggaatgcgcttgcccatcgtgttgaatgtggctaaccgcgcgctggcttcgccc
ttgaatatccattgcgatcactccgatatgtatttggggcgtgatagcgggtggatcaat
ctatgcacttgcaacccccaagaggtctatgattttaccttgatggcttttaagctggct
gaacatacagaagtgcgcgtgccagtcatggtgcatcaagacgggtttttatcctcccac
accgtgcaaaatgtccgccccttgagcgatgaagtggcttatgaatttgtgggcgattat
gtgggcgtgcatcccatgcttgattttgatcgcccagtgagctatggcgcacaagcggag
gaagaatggcattttgagcataaagccaaactccaccacgctattatgcactccaaagcc
attttagagagcgtgtttagcgattttgccaagattacggggcggcgttaccacattgtg
gaatctttcatggctgaagatgcggaggtggtgatctttgctctgggcacgacctatgaa
tctgccattgtagctgccaagaaagccagacaaaagggcattaaagcaggcgtggtgacc
acgcatttactgcgccccttcccctttgagcagattagcgaggtgcttaaaaacgccaaa
gccttagccatcatggataaaagctccccctctggtgcgatgggcgcgatgtttaacgag
ctggccgctagtttgtatcaggcaaaagggtgtaagcaccccgtgctgagtaattacatc
tatgggctgggtgggcgcgacttgacccaagcggatttagatggcatttttgaggaattg
gttcaagatgtgcaaaaaggcacgctgacccaccccacccaacaattcatcggactcaat
ggtcctaaattgtctttcttttaa

DBGET integrated database retrieval system