KEGG   Helicobacter bizzozeronii: HBZC1_16280Help
Entry
HBZC1_16280       CDS       T01540                                 

Definition
hypothetical protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
hbi  Helicobacter bizzozeronii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1515663..1516448)
Genome map
AA seq 261 aa AA seqDB search
MQKVLCALAVCAGLVGAKAGVDNKLATSVAQLINKQINKKVEVLETFPLKSNKEFQVVVV
QDPDTKYRIPFLVNRSGSLAVGLTNMFFSESKDDVGFVDSIYHDSQVHNFKQQHSVALNK
LFRAIPKDYVITLKSSVKGVKKDLYIISDPSCPHCRNELGGVHERLKNANVHMVLVGFLG
KESNLKAAHILSKIKNKHSTEDKISLLNKVYATAYKVSPSDVPDDKLQEVEKVTKQVLDT
KLVKGVPFIYEYEESSTASKK
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaagttttgtgtgcgttagcggtgtgtgcgggcttggtgggggcaaaggcgggt
gtggataacaagctggctacaagtgtagcccaactcatcaacaagcagatcaataagaaa
gtggaggtgctagaaactttccccttaaaatccaataaggagttccaagtagtggtggtc
caagatccggataccaaataccgcatcccttttttggtgaatcggagtggttctttggca
gtgggcttaaccaatatgtttttcagtgagagcaaagacgatgtgggctttgtggatagc
atctaccatgattcccaagtccataattttaagcaacaacatagcgtagcactcaacaaa
ttattccgagcaatccctaaggattatgtgatcacactcaaatccagtgttaagggtgtt
aaaaaagacctctacatcatttctgacccctcttgcccgcattgccgtaatgaattgggc
ggtgtccatgagaggcttaaaaatgccaatgtccatatggtgcttgttggattcttgggc
aaggaatctaatctcaaggcggctcatattttgagcaaaatcaaaaataaacacagcaca
gaggacaagattagtttgctcaataaggtctatgctactgcctataaagtttctccctcc
gatgtgcctgatgataaactccaagaagtcgaaaaggtaaccaaacaagttttagacacc
aaactggttaagggcgtgcctttcatttatgaatacgaagagtctagcacggctagtaaa
aagtaa

DBGET integrated database retrieval system