KEGG   Helicobacter bizzozeronii: HBZC1_16540Help
Entry
HBZC1_16540       CDS       T01540                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
hbi  Helicobacter bizzozeronii
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hbi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HBZC1_16540
  Amino acid metabolism
   00330 Arginine and proline metabolism
    HBZC1_16540
Enzymes [BR:hbi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     HBZC1_16540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1540892..1541866
Genome map
AA seq 324 aa AA seqDB search
MVLVALSAELGASRRGSNKGVECLRQALVQKYPEVAKHAVFIKEEQCALDISFKYAKRFE
DYYLFCRDALIPGMQKVFAEHQFPIILSSEHSNAFGIIQALRSQHPKEKIGILYLDAHAD
IHTAHDSHSGNIHGMPLGMVLNKVHAGPNDLSAQEKEYWQNLCSLGLEKRVVPFDPSHLV
YFGVRSTERSEDEVIAEYNIPLFSVAQIREDMFGVVQKAKEHLKGIHTIYLSLDVDVMDG
GIFTSTGVREKRGLYPHELQDLLQLLLDTFGDRLAAIEITEYNPDMHKGGRDDQQDVLEL
LMSATRYALQRKKHPHKAHSRDHA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggttttagtcgcgttatcagcagaattaggggcatctaggcgggggagcaataagggc
gtggaatgtttgaggcaggcattggtccaaaaatacccagaggttgccaagcatgctgtt
tttatcaaggaagagcagtgcgcgctagatatttcttttaaatacgccaaacgctttgaa
gattactacttattttgcagagatgccttgatcccgggcatgcaaaaggtgtttgcagaa
caccaattccccattattctaagctcagaacactccaatgcctttggcattatccaagcc
ttgcgcagccaacatcctaaagaaaaaattgggattttgtatttggatgcgcatgcggac
atccacaccgcccatgacagccactcaggcaatatccatggcatgcccttaggcatggtg
cttaacaaagtgcatgctggtcctaatgatttgagcgcacaagaaaaggaatattggcaa
aatctctgctctttagggcttgaaaaaagggtcgtgccctttgatccttctcatttggtg
tattttggtgtgcgtagtaccgagcgtagcgaagatgaggtgatcgctgaatacaatatc
ccccttttcagtgtagcccaaattagagaggacatgtttggcgtggtgcaaaaggctaaa
gaacacctcaagggtatccacacaatttatttgagcctggatgttgatgtgatggatggg
gggattttcacttctacgggcgtgcgtgaaaaacgcggtctatacccccatgaattgcaa
gatttattgcaattattgctcgatacttttggcgatcgcctagcagccattgagatcacc
gaatacaaccctgacatgcacaaaggtgggcgtgatgatcaacaagatgtcttagaactc
ttgatgagcgcaacccgctatgccttgcaacgcaagaaacacccccacaaagcccattca
agagatcatgcatga

DBGET integrated database retrieval system