KEGG   Halogeometricum borinquense: Hbor_01450Help
Entry
Hbor_01450        CDS       T01359                                 

Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
hbo  Halogeometricum borinquense
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hbo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Hbor_01450
Enzymes [BR:hbo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Hbor_01450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
123842..124585
Genome map
AA seq 247 aa AA seqDB search
MSQQVRVAVFRPDDDRMSDAVELLDSLGATPIPDPMLAVEPTGAMPDSGDYVILTSKTGV
ELLAEDGWEPNGSTLACIGPATADAARDSGWSVDIVPEEYTSSGLVERLRDDVANATVEV
ARSDHGSDVLTDGLREAGADLHETVLYRLVRPEGAGQSTVMVAGDEVEGVCFSSSLTVEN
FLDAAAERGVREEVIEGLNSLVVGVIGPPTRETAESYGINVDVVPENADFEELACAVVET
AAPTYHK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgagccagcaggtccgcgtagccgtcttccggccggacgacgaccggatgagcgacgcc
gtagaactcctcgactcgctcggcgcaacgcccatcccggatccgatgctggctgtcgaa
ccgacaggtgcgatgcccgactcgggagactacgtcatcctgacgagtaagaccggcgtc
gagcttctcgcggaggacggctgggaacccaacgggtctacgctggcctgtatcggaccc
gcgacggccgacgccgcccgtgattccggatggagcgtcgatatcgtccccgaagagtac
acctcatcgggactggtcgagcgtctccgtgacgacgtggcgaacgcgacggtcgaagtc
gcccggagcgaccacggaagcgacgtactcaccgacggccttcgtgaagccggtgccgac
cttcacgagacggttctgtaccgacttgtccgccccgaaggcgcgggtcagtcaacggtg
atggtcgcaggcgacgaagtcgaaggcgtctgcttcagttcctcgctgacggtggagaac
ttcctcgatgccgccgccgaacgcggcgtccgcgaggaggtcatcgaagggctgaacagc
ctcgtcgtcggcgttatcggcccgccgacgcgtgagacagccgaatcgtacggcatcaac
gtagatgtggttccggagaacgccgacttcgaggaactcgcgtgcgccgtcgttgagacg
gctgcgccgacgtaccacaagtag

DBGET integrated database retrieval system