KEGG   Halogeometricum borinquense: Hbor_02880Help
Entry
Hbor_02880        CDS       T01359                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
hbo  Halogeometricum borinquense
Pathway
hbo00260  Glycine, serine and threonine metabolism
hbo00750  Vitamin B6 metabolism
hbo01100  Metabolic pathways
hbo01110  Biosynthesis of secondary metabolites
hbo01120  Microbial metabolism in diverse environments
hbo01230  Biosynthesis of amino acids
Module
hbo_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hbo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hbor_02880
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Hbor_02880
Enzymes [BR:hbo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Hbor_02880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADQ65898
UniProt: E4NTF3
Position
267284..268549
Genome map
AA seq 421 aa AA seqDB search
MSLELTAPAPDVPDVADDGVWLECIETGETYAPFDEIRYTSDHGHLLEVRYANPPTFEDF
QGQGRGVWRYRSALPFEEGVSLPEGDTPLHEAPRLREDIGVNTLRIKHEGMNPTGSFKDR
GMTVGVRVAKELGVDRLACASTGNTSAALAAYGARGGMETLVLLPSGKVAAGKIAQAALH
DARILEVDGNFDSCLDIVQELAERGEVYLLNSLNPFRLEGQKTIGLEILEAFRDDYGRFP
DRIVLPVGNAGNTSALYKAFRELVQSGALDPEQVPKLTGVQAEGAAPMVEAIENGWEDTK
RWDEVETRATAIRIGNPVNAPKALPGIRETDGTAVAVSDEEITEAQRDLAGEGIGVEPAS
AASVAGLQKLRHEGVVDPDEDVVCLTTGHLLKDPDAAFEAGGEPEPVANDTEAVLEHIGA
E
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgagcctcgaactcaccgcccccgcgccggacgttccggacgttgcagacgacggtgtg
tggttagagtgtatcgagacgggcgagacgtacgccccgttcgacgagattcggtacaca
agcgaccacggtcacttactcgaagtgcgctatgcgaacccgccgacgttcgaagacttc
caagggcagggtcgcggcgtctggcggtatcgctcggcgctcccgttcgaggagggtgtg
agtctgcccgagggtgacacgccccttcacgaagccccgcgactgcgcgaggatatcggc
gtgaacacgctccgaatcaaacacgaggggatgaatccgacgggcagtttcaaagaccga
ggcatgactgtcggcgtccgcgtggccaaggaactcggcgttgaccgtctcgcatgtgct
tccactgggaacacctccgccgcactcgccgcctacggcgcgcgcggcgggatggagacg
ctggtgcttctcccgtccgggaaagtcgccgccgggaagattgcgcaggccgcgcttcac
gacgcgcgcattctcgaagttgacggaaacttcgactcctgtctcgatatcgtccaagag
ttggccgaacgcggtgaagtctacctgttgaactcgctcaacccgttccggttagagggg
cagaagacaatcggactggagattctggaggcgttccgcgacgactacggtcgcttcccc
gatagaatcgtccttcccgtcggcaacgcaggtaacacttcggcgctgtacaaggcgttc
cgcgaactcgttcagtcgggcgcactcgatcccgaacaggtgccgaaactcaccggcgtc
caagccgagggtgcggccccgatggtcgaagccatcgagaacggttgggaggatacgaag
cgctgggacgaggtggagacgcgtgcgacggccatccgcatcggcaacccggtcaacgca
ccgaaggcgctccccggcatccgcgagacggatgggacggccgtcgccgtctccgacgag
gagattaccgaggcgcagcgagacttggcaggcgagggtatcggtgtcgaacccgcctcc
gccgcatccgtcgccggtcttcaaaaactccgccacgagggcgtcgtagaccccgacgag
gacgtggtgtgtctcactaccggtcatctcctgaaggaccccgacgccgcgttcgaggcg
ggcggcgaacccgaaccggtggcaaacgacaccgaagccgtgttagaacacatcggcgcg
gagtga

DBGET integrated database retrieval system