KEGG   Halogeometricum borinquense: Hbor_02950Help
Entry
Hbor_02950        CDS       T01359                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
hbo  Halogeometricum borinquense
Pathway
hbo00010  Glycolysis / Gluconeogenesis
hbo00020  Citrate cycle (TCA cycle)
hbo00620  Pyruvate metabolism
hbo01100  Metabolic pathways
hbo01110  Biosynthesis of secondary metabolites
hbo01120  Microbial metabolism in diverse environments
hbo01130  Biosynthesis of antibiotics
hbo01200  Carbon metabolism
Module
hbo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:hbo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hbor_02950
   00020 Citrate cycle (TCA cycle)
    Hbor_02950
   00620 Pyruvate metabolism
    Hbor_02950
Enzymes [BR:hbo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Hbor_02950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 GCV_H RnfC_N
Motif
Other DBs
NCBI-ProteinID: ADQ65905
UniProt: E4NTG0
Position
complement(274344..275873)
Genome map
AA seq 509 aa AA seqDB search
MAIEEFKLPDVGEGVAEGELVTWHVTPGDTVEEDQVVAEVETDKALVDVPSPYNGTVKEL
LAEEGEMVPVGDVIITFEVEGEGDEEVAAEAEPETDEVSEEAAETGETETSSGRVFASPS
VRQLARELGVDIASVSGTGPSGRVTESDVREAAESDDESAASDDGPREVSFSGDDAVSKS
GDVGNGEVTTGAASVEAAGREKTLAAPATRRVAEEKGVDINNVPASEQRDGQAFVSAEAV
HEYAEAQQAAQAADAQALAEEEGAGEAEAAEAAETGPVAGERVPYRGVRRAIGDQMERSK
YTAPHVTHHDEVDVTELVELREELKPLAEEQDTRLTYMPFVMKAVIAALKEFPFMNSQLD
EENEEIVLRDEYNIGVATATDVGLMVPVVDDADGKGLLDLSRDMNEKVEKARERKIAPEE
MQGGTFTITNIGGIGGEYATPIINYPEVAILALGAIKEKPRVVDGDIVPRKVLTLSLSFD
HRIVDGAVGARFTNKVKEYLMNPKLLLLE
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaggaattcaaactacccgacgttggcgagggcgtcgccgagggcgaactc
gtcacgtggcatgtcacgcctggcgatacagtcgaggaagatcaagtcgtcgcagaggtc
gagaccgacaaagcgctcgtggacgttccgtcaccgtacaacggcacggtgaaagaactc
ctcgccgaggagggcgaaatggtccccgtcggcgacgtcatcatcaccttcgaggtcgag
ggtgagggcgacgaggaagttgcggccgaagcagaacccgaaacggacgaggtgtccgaa
gaagcggccgaaacgggtgaaaccgagacatcctcgggacgcgtgttcgcgtcgccgagc
gtccgacaactcgcgcgcgaactcggtgttgacatcgcatccgtctcgggcactggcccg
agtggccgagtaaccgaatccgacgtccgcgaggctgcagagtccgacgacgagtccgcg
gcgtccgacgacggcccgcgagaagtttcgttctccggcgacgacgccgtctcgaagtcc
ggagatgtcggaaacggcgaggtcaccacgggcgcggcgtcggtcgaagccgccggccgc
gagaagacgctggccgcccccgcgacgcgacgagtcgccgaggaaaaaggcgtagacatc
aacaacgtgccggcgagcgagcagcgagacgggcaggcgttcgtctccgccgaggccgtc
cacgagtacgcagaagcgcaacaggccgcccaagcggccgacgcgcaggcactcgccgaa
gaagaaggtgctggcgaagccgaagccgcggaagcggccgaaaccggacccgttgcgggc
gaacgcgtcccctaccgcggcgtccgtcgcgccatcggcgaccagatggagcgctcgaag
tacaccgcgccgcacgtcactcaccacgacgaggttgacgtgaccgaactggtcgaactc
cgcgaggaactgaaacccctcgccgaggaacaggacacgcgactcacctacatgccgttc
gtgatgaaggccgtcatcgcggccctcaaggagttcccgttcatgaactcccaactcgac
gaggagaacgaggaaatcgtcctccgcgacgagtacaacatcggcgtcgccaccgcgacg
gacgttggtctgatggttccggtcgtcgacgatgcggacggcaagggtctcttggacctc
tcgcgtgacatgaacgaaaaggtcgagaaggcccgcgagcgcaaaatcgcgcccgaggaa
atgcagggcggcactttcaccatcaccaacatcggcggcatcggcggcgagtacgccacg
cccatcatcaactaccccgaggtagccatcctcgcactcggtgcgatcaaggagaaaccg
cgcgtggttgacggcgacatcgtcccgcggaaagttctcactctgtcgctgtcgttcgat
caccgcatcgtagacggcgcagtcggcgctcgattcaccaacaaggtcaaggagtacctc
atgaaccccaaactcctcttactcgaatag

DBGET integrated database retrieval system