KEGG   Halogeometricum borinquense: Hbor_03400Help
Entry
Hbor_03400        CDS       T01359                                 

Definition
protoporphyrin ix magnesium-chelatase (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
hbo  Halogeometricum borinquense
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hbo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Hbor_03400
Enzymes [BR:hbo01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Hbor_03400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
327871..330087
Genome map
AA seq 738 aa AA seqDB search
MSAETLPFPAIVGQEELKRALLAVGVNEQIDGLLVRGEKGTAKSTAVRALTDLLPEQTVV
AACPYGCPPDDPTRQCDSCRERDDYDVETRPVPLVTLPLGATRDRVAGTLSVSDALAGDA
SFDPGLLARANRGILYVDEVNLLEDHLVDLLLDAAASGVNRVERDGVSVEHPAEFTLIGT
MNPEEGDLRPQLRDRFALQATVTGCRSVEDRVTIIDRALDGSHDARNTDGGDTDGVSNEA
GLAADQYDDAVATLEQDVRTAHNRLERVTLPTDFKVEIAELCLDAGVEGHRADIAIARTA
RTLAALDGRTKVIGGDVRDAAELALPHRLRSRPFDDAPDTDDVLDDHFEDESDSGESGDG
ETGDDADTGDDEPGDGEDSADGETGGDTDASDADGTDSDTGDGDESGAADDDSDGSQRPD
RTGSSDDERTAEESEAETAADDDQRGDSPDEDGSSDDEGDGGDEDGNPDEATPLLPGQQR
AAVGAADEPPVDDTALRSETPGEGTRATVGESRHGRGSRVRTEPATNTDDIDVPASVRAA
ASNGRTQIDRSDLRTSVNRGTARTLIVFVVDASASMRPAMRETKGTVMSLLEDAYQQRDE
VAFVAVAGDEAEVVLPPTDSVSLAARHLKQLPAGDRTPLPSGLDAAHRLVTRADADSSLV
VVVTDGRANVADGSPTAATRSAARHLATSDASVVLVDAGDDGTGLTDILESETGARRISL
ADLSAERVSEAAASVHDA
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcagagacactgccgttcccggcaatcgtcggacaagaggagttaaagcgggcg
ctgttggccgttggcgtcaacgaacagatcgacggactcctcgtccgcggcgagaaggga
acggcgaaatcgactgccgtgcgggcactcaccgacctgcttcccgaacagacggtggtc
gcggcgtgtccgtacggctgtccgccggacgacccgacgcggcagtgtgactcctgccgg
gagcgtgacgactacgacgtggagacgcgcccggttccgctcgtcacccttccgctcgga
gcgacccgcgaccgtgtggcgggaacgctgtctgtctcggacgcgctcgccggtgacgcg
tcgttcgaccccggtcttctcgctcgcgcgaaccgcggtattctctacgttgacgaggtc
aatctgttggaggaccatctcgttgatctgttattggacgccgcggccagcggcgtcaat
cgcgtcgaacgtgacggtgtgagtgtcgagcatcccgccgagttcacgctcatcgggacg
atgaaccccgaggaaggcgaccttcgtccgcaacttcgagaccgctttgcgctccaagcg
accgtcaccgggtgccgctccgtcgaggaccgcgtgacgatcatcgaccgcgcgctcgac
ggcagtcacgacgcccgaaataccgacggtggggataccgacggcgtgagcaacgaggcg
ggactggccgccgaccaatatgacgacgcggtggcgacgctcgaacaggacgtacgaacg
gcccataaccggttggaacgcgttactctcccgaccgatttcaaggtcgaaatcgcggaa
ctctgtctcgacgcgggtgttgagggtcaccgtgccgatatcgccatcgcccggacggcg
cgaacgctcgcggcgctcgacggccgaaccaaagtcatcggcggcgacgttcgtgacgcc
gccgaactcgcgcttccccatcggcttcgaagccgcccgttcgacgacgcacctgacacc
gacgacgttctcgacgaccacttcgaggatgagtctgattcgggtgaatccggtgacggt
gaaacgggagatgacgccgatactggcgacgacgaacccggtgacggcgaggacagtgct
gacggcgaaacgggaggcgacacggacgcttccgacgcggacggcaccgactccgatacc
ggcgacggtgacgaatccggcgctgctgacgacgactccgatgggtcgcaacgccccgac
cgaactggctcgtcggacgatgaacggacggccgaggagagcgaggcggaaacagccgct
gacgacgaccagcgcggcgactcgccggacgaagacggcagcagcgacgacgaaggggac
ggtggcgacgaggacggcaacccggacgaagcgacgccgcttctgcccggacagcagcgc
gcggcggtcggtgcggccgacgaaccgccggtggatgacacggcactccgctcggagacg
cccggcgaagggacgcgggctaccgtaggtgagtcgcgccacggacgtggatcacgggtc
cgaaccgaaccggcgacgaacaccgacgacattgacgttccggcctcggtccgggcggcg
gcgtccaacggccgaacccaaatcgaccggagcgatctcagaacgtccgtcaaccgcggt
actgcccgaacgctcatcgtgttcgtcgtggacgcgagcgcctcgatgcgccccgcgatg
cgcgagacgaaaggcaccgtcatgtcgcttctcgaagacgcctaccaacagcgagatgaa
gtcgcgttcgtcgcagtcgccggtgacgaggccgaagtcgtcctcccaccgactgacagc
gtgtcgctcgcggcgcgccacctgaagcaactccctgcgggcgaccgaacgccgcttccc
tccggattggacgccgcgcaccgactcgtcacgcgcgccgatgcggactcgtctctcgtt
gtcgtcgtaaccgacggtcgcgcgaacgtcgctgacggcagtccgaccgcagcgacgcgg
tcggcggcgcgacacctcgcaaccagcgacgcgtcggtggtcctcgtcgatgccggagac
gacggtaccgggttgactgacattctcgaatccgaaaccggcgctcggcgcatttcgctc
gctgatctttcggcagagcgagtgtcggaagccgcggcgtcggttcacgacgcttga

DBGET integrated database retrieval system