KEGG   Halogeometricum borinquense: Hbor_10980Help
Entry
Hbor_10980        CDS       T01359                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
hbo  Halogeometricum borinquense
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:hbo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hbor_10980
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Hbor_10980
   00640 Propanoate metabolism
    Hbor_10980
   00660 C5-Branched dibasic acid metabolism
    Hbor_10980
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Hbor_10980
Enzymes [BR:hbo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Hbor_10980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1019453..1020598)
Genome map
AA seq 381 aa AA seqDB search
MRLHEYQAKDIFAEAGIPVPESRLATSVDEVMEAVEEIGYPAAIKAQVHVGGRGKAGGIK
IATDEDEAREAAEDILGMDLKGYTVEKVLVEAGVDFENELYVGITMDRGEGKPVAMVSTE
GGVNIEEVAEETPEAIAREHIDPAFGLHPYQARKVVYEAGIPHDVAGDVATILSTLYDLY
ESKDASDIEINPVMITSDREVVAADAVMNIDSDALFRHPDLAEMEDEAAEDDLERKANDY
GFDYVRLSGNVGIIGNGAGLVMTTLDLVDYYGGEPANFLDIGGGAKAERVANALDMVFSD
ENVDAVVFNIFGGITRGDEVAKGINEALESFDEIPKKVVVRLAGTNAEEGMEILNTDLVE
VEKTLEDAVQQAVENAQEAGQ
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgagactccacgagtatcaggcgaaggatatcttcgccgaggcggggattccggtgccc
gagtcccgtctcgcaacgtcggttgacgaagtgatggaggcggtagaggagatcggctac
cctgccgcaatcaaagcgcaagtacacgttggcggccgtggcaaagcgggcggcatcaag
atagccacagacgaggacgaagcacgagaggccgccgaggacatcctcgggatggacctc
aagggctacaccgtcgagaaagtgctcgttgaggccggtgtggacttcgagaacgaactc
tacgtcggtatcacgatggaccgcggcgagggcaagcccgttgccatggtctccaccgaa
ggtggcgtcaacatcgaagaagtcgcagaagagacgcccgaagccatcgctcgggaacac
atcgaccctgcgttcggtctgcacccctatcaggcgcggaaagtcgtctacgaggcgggc
attccccacgacgtagcgggcgacgtagccacgatcctctcgacgctctacgacctctac
gagtcgaaggacgcctcggacatcgaaatcaacccggtcatgatcacgtcggaccgcgag
gtcgtcgcggccgacgccgtgatgaacatcgactccgacgccctgttccgccatcccgac
ctcgcggagatggaggacgaagcggccgaggacgacctcgaacgcaaggcgaacgattac
ggcttcgactacgttcgcctttcgggcaacgtcggcatcatcggtaacggggccggtctc
gtcatgacgacgctggacctcgtggactactacggcggcgaacccgccaacttcctcgat
atcggtggcggtgcgaaggccgaacgcgtggccaacgctctcgatatggtgttctccgac
gagaacgttgacgccgtcgtgttcaacatcttcggcggcatcacccgcggcgacgaggtt
gccaagggtatcaacgaggcgctcgaatccttcgacgagatcccgaagaaggttgtcgtc
cgcctcgcaggcaccaacgccgaggagggaatggagattctcaacacggacctcgtggag
gtcgaaaagacgctcgaagacgcggtccaacaggccgtcgagaacgcacaggaggcaggt
caatga

DBGET integrated database retrieval system