KEGG   Halogeometricum borinquense: Hbor_12270Help
Entry
Hbor_12270        CDS       T01359                                 

Definition
(GenBank) peptidase family protein
Organism
hbo  Halogeometricum borinquense
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1135836..1136900)
Genome map
AA seq 354 aa AA seqDB search
MDDTRRTFLKDLLTTPSPSGYEADGQRVWVSYVEEFADEVRVDDYGNAVAVHEGTGGGPE
IAFTGHADEIGYIVRDVTDDGFLRIAAIGGADRTVSKGQHVTVHAADGEVPGVIGQTAIH
LRDVGEEEYDDLEEQFVDIGAADEAEAHELVEVGDPLTVETRVRDLHGSRMAARGMDNRV
GTWAAAEALRHAVEADVDATVYAVSTVQEELGVQGAKMVGYDLNPDAAVAIDVTHATDNP
DVESKHKGPVELGEGPVITRGSANHPAVVELARNAANDADVDVQLQAAGIRTGTDADAFY
TSRSGIPSLNIGIPNRYMHTPVEVVDTEDLDAIATLLGSMAVGAEDAAPFGVNV
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggacgatacacgacgaacgttcctgaaggacctcctgacgacgccgagtccctccggt
tacgaggctgacgggcagcgcgtctgggtttcgtacgtcgaggagttcgccgacgaagtg
cgcgttgacgactacggcaacgccgttgcggtccacgaaggaacgggtgggggacccgaa
atcgccttcacgggccacgccgacgagatcgggtacattgtccgcgacgtgaccgacgat
ggattcctccgcatcgcggctatcggcggcgctgaccgtactgtttcgaagggccagcac
gtcaccgtgcacgcggccgacggtgaggttccgggcgttatcggacagacggcgattcac
ctccgcgacgttggcgaggaggagtacgacgacttagaagaacagttcgtggacatcggc
gcggcagacgaggcggaagcgcacgaactcgtcgaagtcggtgacccgctaaccgtcgaa
acgcgcgtccgcgacctgcacggatcacgcatggccgcccgcgggatggacaaccgtgtc
gggacgtgggccgccgccgaagccctccgacacgccgtcgaagcggacgtggacgcgacg
gtctacgccgtgagtacagtgcaagaggaactcggcgtccagggcgcgaagatggtcggc
tacgacctgaaccccgacgccgccgtcgccatcgacgtgacgcacgcgacggacaaccct
gatgtagagagtaaacacaaaggtcccgtcgaactcggcgaagggccggtcatcactcgc
gggagtgcgaaccatcctgccgtggtcgaactcgcacgcaacgcggccaacgacgccgac
gttgacgtgcagttgcaggctgctgggattcggaccggtaccgacgccgacgccttctac
acctcccgaagcgggattccatcgctgaatatcggcatcccgaaccgctacatgcacacg
ccggtcgaagtggtggatactgaagacctcgacgcgattgcgacgcttctcgggtcgatg
gcggtaggcgctgaagacgccgcaccgttcggtgtgaacgtataa

DBGET integrated database retrieval system