KEGG   Halogeometricum borinquense: Hbor_12890Help
Entry
Hbor_12890        CDS       T01359                                 

Definition
succinate dehydrogenase subunit d (EC:1.3.5.1)
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
hbo  Halogeometricum borinquense
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:hbo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hbor_12890
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Hbor_12890
   00650 Butanoate metabolism
    Hbor_12890
  Energy metabolism
   00190 Oxidative phosphorylation
    Hbor_12890
   00720 Carbon fixation pathways in prokaryotes
    Hbor_12890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1186174..1186551)
Genome map
AA seq 125 aa AA seqDB search
MAEHYSSFERGGRRWLWQRITAAFLVVVLAFHFFLLHFVHHAADVTFQMSAARMQQWTYY
SLMVLFLITATFHGVNGVYNALVNQGIEGTRKTAVKWTLIAASILLIVQGIRTANEWAGI
ALLPF
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggcagaacactactcctcgttcgaacgtggcggccgccgatggctctggcagcgcatc
acggccgcgttcctcgtggtagtgctagcgttccacttcttcctgcttcacttcgtccac
cacgcggccgacgtgacgttccagatgtcggcggcacggatgcagcagtggacgtactac
tcgctgatggtgctgttcctcatcaccgcgacgttccacggcgtcaacggcgtctacaac
gcgctggtgaatcaggggatcgaaggcacgcgcaagactgccgtcaagtggacgctgatc
gcagcgagcatcctcctgatcgtgcagggaatcagaaccgcaaacgagtgggcgggaatc
gctctcctccccttctaa

DBGET integrated database retrieval system