KEGG   Halogeometricum borinquense: Hbor_14000Help
Entry
Hbor_14000        CDS       T01359                                 

Definition
histone acetyltransferase, elp3 family
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
hbo  Halogeometricum borinquense
Brite
Enzymes [BR:hbo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Hbor_14000
Transfer RNA biogenesis [BR:hbo03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Hbor_14000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1315453..1317213)
Genome map
AA seq 586 aa AA seqDB search
MSDTLNLETTRLKANENLRSNGRCGGDAAVSADTDPTETEDPTETEAFRRTCETLVERIL
DGEIEKDDLESAKLNACSKHSSPKVPKNADILQYAPDGRREEVKEVVQRKPVRTASGVSP
VAIMTSPHMCPHGKCLYCPGGPASEFSSSQSYTGHEPAAARGVQNDYDPYGQVTLRLEQL
RHIGHPVDKVELILMGGTMTARSHDYQEWFVKRALEAMNDYDLDSDPQPAEDQSFKPDPE
DVEFRYLEDVIAENETADVRNIGTTFETKPDWCDPEQINRMLDLGATKVEVGVQTTYERI
NREMHRGHGVQASLDANRRLRDSAFKVGFHMMPGQPGMTKEMCVEDFRQLFENSDWRPDY
LKIYPTLVVRDTITYDMWRRDEYEPLNNEEAADVVAEVMGMIPKYTRLQRVQRDIPADFI
DAGVWKSNLRQLAEQRAAEKGIELNDIRSREVGMNDADPDPERVELQVETYEAAEGTEHF
ISFEDPAENLLIGFCRLRFPHDPVRRELENAALVRELHVYGSEVGLGGDGDWQHKGYGRR
LLEHAEEIARDAGYEKMSVISGIGVREYYKQKLGYHQDGPYVSKRF
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacacccttaacctcgaaacgacgcgactgaaagctaatgagaatcttcgctcg
aacggccgatgcggcggtgatgccgccgtgagcgccgacacagaccccacggaaacggag
gacccgacggagacggaggcgttccgacgcacctgcgagacgttggtcgaacgaatcctc
gacggcgaaatcgagaaagacgacttggagtcagccaagttgaacgcctgttcgaaacac
tcctcgccgaaggtgccgaaaaacgccgatatcctccagtacgcccccgacggacggcgc
gaggaggtcaaagaggtcgtccagcgaaagcccgttcggactgcctcgggcgtttcgccg
gtcgccatcatgacttccccgcacatgtgcccgcacgggaagtgtctgtactgtccgggc
ggtcccgcctcggagttctcctcgtcgcagtcgtacacggggcacgaacctgccgcggcg
cgcggtgtccagaacgactacgacccgtacggacaggtgacgctccgcctcgaacaactc
cgtcacatcggccatcctgtggacaaggtggaactcatcctgatgggcgggacgatgacc
gcgcggagccacgactatcaggagtggttcgtcaagcgcgcgcttgaggcgatgaacgac
tacgacctcgactcggacccgcaacccgcggaagatcagtcgttcaagccggaccccgag
gacgtagagttccgctacttggaggacgttatcgcggagaacgagacggccgacgtgcgc
aacatcgggacgacgttcgagacgaaacccgactggtgtgacccagaacagatcaaccgg
atgctcgatctgggcgcgacgaaggtggaagtcggcgtccaaaccacctacgagcgaatc
aaccgcgaaatgcaccgcggtcacggcgtgcaggcctctctcgatgcgaaccgccgactc
cgcgactcggcgttcaaggtgggcttccacatgatgcccggacagcccgggatgaccaag
gagatgtgcgtcgaggacttccggcagttgttcgagaactcggactggcgcccggactac
ctgaagatttacccgacgctcgtcgtccgcgacaccatcacctacgacatgtggcggcgt
gacgagtacgaacccttgaacaacgaagaagccgcggacgtggtggccgaagtgatgggg
atgattccgaagtacacccgactgcaacgcgtccagcgagacatcccggcggacttcatc
gacgcgggcgtctggaagtcgaacctgcgccaactggccgagcaacgcgcagcagagaag
gggatcgaactcaacgacatccgctcgcgcgaggtcggaatgaacgacgccgacccggac
ccagaacgcgtcgaactccaagtcgagacgtacgaggccgcagaaggtaccgaacacttc
atctcgttcgaggaccccgcagagaacctcctcatcggcttctgtcgccttcgcttcccg
cacgacccggtccgacgagagttggagaacgccgcactcgtccgcgaactccacgtctac
gggtcggaggtcggactcggcggcgacggcgactggcagcacaagggctacggccgtcgc
ctcctcgaacacgcggaggagatcgcacgagacgccgggtacgaaaagatgagcgtcatc
tcagggatcggcgtccgcgagtactacaagcagaagttgggctatcaccaagacggtccg
tacgtttcgaagcggttctga

DBGET integrated database retrieval system