KEGG   Halogeometricum borinquense: Hbor_14350Help
Entry
Hbor_14350        CDS       T01359                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hbo  Halogeometricum borinquense
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hbo00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1348465..1349631
Genome map
AA seq 388 aa AA seqDB search
MRTVDAAGLEIGDDHPPRIMGVLNVSKESPYEPSVFNDAGEAAKYVDTALIDEGADIVDV
GLESANKRFEVLSAEEELDRLDTAVEVLESVSGDAVFSIETRYHEVADEALSRGFDMVND
ICGFADPEMPTVCTDHDAAVAKMASPPDLERPGAIEEVDDIYDALAQNGFTDKTIVDPAF
GGWSEAKTLEHDRETLRRLREFRGYGRPILVSINRKNFLREVAGRDTEEALPVSLAATSM
AVERGAHVIRTHDVAETRDAALIGKEFARHRTRKSGDVTVEELDVTTPREVERHLDRLGV
ESPASIATEAVVRVFELDGLSDEDVRTLAAAAGDAGATVARGTTADGADSHCVLLLGTAR
ALCETVAFSEGESESLATALHSVENGVL
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaccgtcgatgcggccggactcgaaatcggagacgaccacccgccgagaattatg
ggtgtactgaacgtctcgaaggagtcaccgtacgaaccgagcgtgttcaacgacgccggt
gaggccgccaagtacgtcgataccgcgcttatcgacgaaggagcagacatcgttgacgtg
gggttagagtccgcaaacaagcgattcgaggtcctctccgcagaagaggaactggaccgc
ctcgataccgccgtcgaggtactcgaaagcgtctccggagacgccgtgttctccatcgaa
acgcggtaccacgaagtcgcagacgaggcgctctcgcgtggattcgacatggtaaacgac
atctgcggattcgctgacccggagatgccgacagtctgtacggaccacgacgccgccgtg
gcgaagatggcgtcaccgccggatctcgaacggccgggcgctatcgaggaagtagacgac
atctacgacgcactggcgcagaacggtttcaccgacaaaacaatcgttgacccggcgttt
ggcggctggtccgaagcgaaaacactcgaacacgaccgcgagacgctgcgccgtctccgc
gagttccgtggatacggacgaccgattctcgtctccatcaaccggaagaacttcctccgt
gaggtggccggacgcgacaccgaggaggcgcttcccgtctcactggcggccacgtcgatg
gccgtcgagcgcggtgcgcacgtcatccggacgcacgacgtggccgaaacacgcgatgcg
gcgctgatcggaaaggagttcgcccggcatcgaacccgcaaatccggggatgtaaccgtc
gaagaactcgacgtgacgacgccccgtgaggtagagcgccatctggaccgcctcggtgtc
gaatcgccggcatcgattgcaaccgaagccgtcgtacgcgtcttcgaactcgacggcctc
tcggatgaggacgtacggacgctcgccgctgctgcaggagatgcgggggcaacggtggcc
cgcggaacgacggctgacggcgctgacagccattgtgtccttcttctcgggacggcacgc
gccctgtgcgagacggtcgcgttctcggagggagaatccgaatcgctcgccacagccctc
cattccgtcgagaacggggttttgtga

DBGET integrated database retrieval system