KEGG   Halogeometricum borinquense: Hbor_14470Help
Entry
Hbor_14470        CDS       T01359                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
hbo  Halogeometricum borinquense
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hbo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Hbor_14470
   00670 One carbon pool by folate
    Hbor_14470
Enzymes [BR:hbo01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Hbor_14470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1358863..1359414
Genome map
AA seq 183 aa AA seqDB search
MNESDSIDRDTTDANAESIEYVLVAAVAENGVIGRDGRMPWHFSEDMAHFKQTTMGHPVI
LGRKTYENIVDAIGEPFPGRMSIVLSSRELDLPEGAVLANSIKEATERAESVAEEMGVET
VYVVGGARVYAQFLPRATRMILTEIHDSYDGETEFPEWEEAMWIETDRDERESFDFVTYE
RVE
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagtcagactcgatcgaccgagacacaacagatgcgaacgccgagagcatcgag
tacgtcctcgtcgctgccgtcgccgagaatggtgttatcggccgtgacggcaggatgccg
tggcacttctccgaagacatggcccacttcaagcagacgacgatgggacatcccgttatt
ctgggtcgcaaaacgtacgagaacatcgtagacgctatcggcgaaccgttccccggtcgg
atgagtatcgtcctctcctcccgtgagttggatctccccgaaggagccgttctcgccaat
tcaatcaaggaagccaccgagcgtgccgagtcggtcgcagaagagatgggcgtcgagacg
gtgtacgtcgtcggcggcgcacgcgtctacgcacagttcctcccgcgggcgacgcggatg
attctgaccgaaattcacgactcgtacgacggcgagacggagtttcctgaatgggaggag
gcgatgtggatcgagacggaccgagacgaacgagagtcgttcgacttcgtgacgtacgaa
cgagtcgagtag

DBGET integrated database retrieval system