KEGG   Halogeometricum borinquense: Hbor_14470Help
Entry
Hbor_14470        CDS       T01359                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
hbo  Halogeometricum borinquense
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hbo00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:hbo00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1358863..1359414
Genome map
AA seq 183 aa AA seqDB search
MNESDSIDRDTTDANAESIEYVLVAAVAENGVIGRDGRMPWHFSEDMAHFKQTTMGHPVI
LGRKTYENIVDAIGEPFPGRMSIVLSSRELDLPEGAVLANSIKEATERAESVAEEMGVET
VYVVGGARVYAQFLPRATRMILTEIHDSYDGETEFPEWEEAMWIETDRDERESFDFVTYE
RVE
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagtcagactcgatcgaccgagacacaacagatgcgaacgccgagagcatcgag
tacgtcctcgtcgctgccgtcgccgagaatggtgttatcggccgtgacggcaggatgccg
tggcacttctccgaagacatggcccacttcaagcagacgacgatgggacatcccgttatt
ctgggtcgcaaaacgtacgagaacatcgtagacgctatcggcgaaccgttccccggtcgg
atgagtatcgtcctctcctcccgtgagttggatctccccgaaggagccgttctcgccaat
tcaatcaaggaagccaccgagcgtgccgagtcggtcgcagaagagatgggcgtcgagacg
gtgtacgtcgtcggcggcgcacgcgtctacgcacagttcctcccgcgggcgacgcggatg
attctgaccgaaattcacgactcgtacgacggcgagacggagtttcctgaatgggaggag
gcgatgtggatcgagacggaccgagacgaacgagagtcgttcgacttcgtgacgtacgaa
cgagtcgagtag

DBGET integrated database retrieval system