KEGG   Halogeometricum borinquense: Hbor_15290Help
Entry
Hbor_15290        CDS       T01359                                 

Definition
(1->4)-alpha-d-glucan branching protein
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
hbo  Halogeometricum borinquense
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hbo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Hbor_15290
Enzymes [BR:hbo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Hbor_15290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1453104..1454591
Genome map
AA seq 495 aa AA seqDB search
MRFDRQSGVFAHVPSLPGPHGIGDLGDGARAFIDWLASAEQSLWQFCPLGPTASIHGHSP
YQSYSAFAGNPLLVDLDQLREDGYLTDDDLEPVPAFSDHEIEYDRVAEYKREQLRTAHER
FQSEATTEDREAFDAFREHESSWLDGYALFMALRTRYDGAWTTWPQEIRTHDEAAINRHR
EELADEISYREFAQFVFDTQWRELKAYANDHGVKLVGDLPIYVALDSADVWAAPEAFDLT
EENEPVAVAGVPPNPNDDGQRWGNPLYDWDYLRENDYDWWMDRLERLFELVDVTRIDHFK
GFDEYWAIPADAHSPAAGEWRDAPGHDFFETVEDQFGDLPFIVEDLGFLDQRMTDLRDRF
GFPGMRVPQYANWCQEGDMYQPMHFPENSVGYTSTHDTNTFVGYYRDLPADQKDCLHYNI
GADGSEIHWSIIDAVWRSNAVIAFTTIQDILGLGAEARFNVPGTTDGNWRWRCTEEGFDE
ELASRLARLTDEHIR
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgagattcgaccggcagtcgggcgttttcgcgcacgttccgtcgctcccgggcccccac
ggaatcggcgacctcggcgacggcgcgcgcgccttcatcgattggctcgcctcggccgaa
cagtcgctgtggcagttctgtccgctcggtccgacagcgtcgattcacggccactcgccg
taccagtcgtactccgcgtttgcgggcaacccactactcgttgacctcgatcaactccgc
gaggacggctatctgactgacgacgacctcgaacccgttcctgcattctccgaccacgaa
atcgagtacgaccgggtagccgagtacaaacgggagcaactccgaaccgcgcacgaacgc
ttccagtccgaggcgaccaccgaggaccgcgaggcgttcgacgcgttccgcgaacacgag
tcgtcgtggctggacggctacgctctgttcatggcgctccgaacccgctacgacggtgcg
tggacgacgtggccacaggagattcgaacgcacgacgaggcggccatcaatcggcaccgc
gaggaactcgcagacgagatttcgtaccgggagttcgcccagttcgtcttcgatacgcag
tggcgcgagttgaaggcgtacgcgaacgatcacggcgtcaaactcgtcggcgacctgcct
atctacgtcgccctcgacagcgcagacgtgtgggccgcacccgaggcgttcgatctgact
gaggagaacgaacccgtcgctgtcgcgggtgtcccgccaaatccgaacgacgacggccaa
cgctggggcaaccccctgtacgactgggactacctccgcgagaacgactacgactggtgg
atggaccgcctcgaacgactgttcgaactcgtggacgtgacccgcatcgaccacttcaaa
ggcttcgatgagtactgggctatcccggcggacgcacactcgcccgcagcgggtgaatgg
cgcgatgccccgggacacgacttcttcgagaccgtcgaggaccagttcggtgatctgccg
ttcatcgtggaagatctcgggttcctcgatcagcgtatgaccgacctccgcgaccggttc
gggttccccggcatgcgcgtcccgcagtacgcaaactggtgccaagagggagatatgtac
caaccgatgcatttccccgaaaacagcgtcggttacacctcgacgcacgacacgaacacg
ttcgtcggctactaccgcgatctgccggctgaccagaaagactgcctccactacaatatc
ggtgcggacggctccgagattcactggtctatcatcgacgccgtctggcgctcgaacgcc
gtcatcgcgttcacgacgatacaggatattctcggcctcggcgcggaggcgcgcttcaac
gttcccggtactactgacggaaactggcggtggcggtgtacagaggagggattcgacgag
gagttagcgtcccgactggcgaggctgaccgacgaacacatccggtga

DBGET integrated database retrieval system