KEGG   Halogeometricum borinquense: Hbor_16380Help
Entry
Hbor_16380        CDS       T01359                                 

Definition
(RefSeq) acyl-CoA synthetase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hbo  Halogeometricum borinquense
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hbo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hbor_16380
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hbor_16380
   00620 Pyruvate metabolism
    Hbor_16380
   00640 Propanoate metabolism
    Hbor_16380
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Hbor_16380
   00680 Methane metabolism
    Hbor_16380
Enzymes [BR:hbo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Hbor_16380
Lipid biosynthesis proteins [BR:hbo01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Hbor_16380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1561985..1563991)
Genome map
AA seq 668 aa AA seqDB search
MEVPDTDEVVHEPAREFVESTNVYEFMQEYGIEDYDELIRRTCTDVDGVAESGVEWFWDE
LVEYLDIDFYEDYDAVRDDTDGPQFSEWYPGGSINVAHNVVDKHAAPDSETRNNVALIWE
GEPGDERKITYHDLHRESNRVANVLESYGIETGDTVGLYMPMVPEVVSILYGCLKVGAIA
VPIFSGFGVDATATRIEDSECSVLFTADGFYRRGGEVTLKDAADDAIAEAGHVEHTVVYD
RLGFEKREDRSIKWRTRDEWWHETVAEADSTYETKELDSSQESMLLYSSGTTGEPKGIVH
THAGVLMQCAKEIYFGFDHKPEDRFFWVSDIGWMMGPWTLIGNHAFGGTVFMYEGAPDHP
EPDRFWDMIERHGLTTFGISPTAIRALRKYGDGYVEQHDLSTLRLLGSTGEPWDPESWMW
FYENVGGGDTPIINISGGTEICGCFLMPMPSQPLKPCSLGGPGLGMNIDIVDSAGDSIAD
THERGFLVARDSCPSMTKSLWSGDERYLKEYWSSFEDPPLWDHGDWAQKDEDGFWFLHGR
ADDALNVAGRKVGPAEIEGVLIEHDAVNQAAAVGVDDDTTGTAVVAYVVLEDDVEPTDEL
REELRELVGEEQGKPFRPRELKFVSEFPKTQSGKIIRRAIAAVHQGEDTGDLSSIENPDA
LDEIRDAR
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atggaggtacccgacacggacgaagtcgtccacgaaccggcgcgggagttcgtggaatcg
acgaacgtctacgagttcatgcaggagtacggtatcgaagactacgacgaactgattcgg
cgcacctgcaccgatgtggacggggtcgcggagtcgggcgtcgagtggttctgggacgaa
ctcgtcgagtacctcgacatcgacttttatgaggactacgacgcagttcgagacgacacc
gacggcccgcagttttccgagtggtatcccggcggcagtatcaacgtcgctcacaacgtc
gtggacaaacacgccgcccccgactcggagacgcgcaacaacgttgcactcatctgggag
ggcgaacccggcgacgagcgcaagataacgtaccacgacctccaccgcgagtccaaccgc
gtggcgaacgtcctcgaatcgtacggcatcgagacgggcgacacggtgggactgtacatg
ccgatggtgcccgaagtcgtctctattctctacggctgtctgaaagtcggtgccatcgcc
gtcccaatcttctccgggttcggcgtggacgccacggcgacgcgaatcgaagactcggag
tgttcggtgcttttcaccgccgacggcttctaccgccggggcggcgaggtcacgctgaag
gacgccgccgacgacgccatcgcggaggccgggcacgtcgaacacaccgtcgtctacgac
cgactgggattcgaaaagcgggaggacagatcgatcaagtggaggactcgtgacgagtgg
tggcacgaaaccgtagccgaggccgacagcacgtacgagacgaaggaactggactcctca
caggagtcgatgctcttgtactcgtcggggacgacgggcgaaccgaagggcatcgtccac
acccacgcgggcgtcctgatgcagtgcgccaaggagatctacttcggcttcgaccacaag
cccgaggaccgcttcttctgggtgtccgacatcgggtggatgatggggccgtggacgctc
atcggcaaccacgccttcggcggcaccgtgttcatgtacgaaggcgcgcccgaccacccc
gaacccgaccggttctgggacatgatcgaacgacacggtctcaccacgttcggcatctcg
ccgacggcgattcgcgccctgcggaagtacggcgacggctacgtggagcaacacgacctc
tcgacgctcagactgctcggttcgacgggcgaaccgtgggaccccgaatcgtggatgtgg
ttctacgagaacgtcggcggtggcgacacgccgatcatcaacatctccggcggcaccgaa
atctgcggctgtttcctcatgccgatgccgagccaaccgctcaaaccgtgttcgctcggt
gggccgggcctcgggatgaacatcgacatcgtggactccgcgggcgacagcatcgcggac
acgcacgaacgcggcttcctcgtcgcccgcgactcctgtccatcgatgacaaagagcctc
tggagcggtgacgaacgctacctgaaggagtactggtcgtcgttcgaggacccgccgctg
tgggaccacggcgactgggcgcagaaggacgaagacggcttctggttcctccacggacgc
gccgacgacgccctgaacgtggccggccggaaggtcggacccgccgagatagagggcgtc
ctcatcgaacacgacgcggtcaatcaggccgccgccgtcggcgttgacgacgacaccacc
ggcaccgccgtcgtcgcctacgtcgtcctcgaagacgatgtcgaaccgacggacgagttg
cgcgaggaactgcgcgaactcgtcggcgaagaacagggcaagccgttccggccgcgcgaa
ctcaagttcgtctcggagttcccgaaaacgcaatcgggcaagatcatccgccgggccatc
gccgccgtccatcagggcgaggacaccggtgacctctccagtatcgagaatcccgacgcg
ttagacgagattcgagacgcgcggtag

DBGET integrated database retrieval system