KEGG   Halogeometricum borinquense: Hbor_16510Help
Entry
Hbor_16510        CDS       T01359                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
hbo  Halogeometricum borinquense
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hbo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Hbor_16510
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Hbor_16510
Enzymes [BR:hbo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Hbor_16510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1573971..1574870
Genome map
AA seq 299 aa AA seqDB search
MNQHTRIIGVPTDYGANRRGVDMGPSALRYAGLVDELSSAGVSTEDAGDLAVPHHAIHDA
DAGGENAKHINEVEEVTTALADAVADALSDEVTPLVLGGDHSIAIGSMVGSARDADIGVV
WFDAHGDFNTPETSPSGNVHGMPLAAALGIGDFEGVEWANAPRLKEENVAIVGLRDVDEN
ETTAIQDSDVTAYTMSDIDERGITEVTQDALDVATNGTDGVHVSLDLDWLDPREAPGVGT
PVRGGVTYREAHAAMELVAESGAMRSLELVEVNPILDEHNETAAVATELAASGFGKRIL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagcacactcggattatcggtgttccgaccgactacggtgcgaaccgacgtggt
gtcgacatgggcccctccgcacttcgatatgcgggtctcgtcgatgaactctcgtcagcg
ggcgtttcgacggaagacgccggtgatctcgcggtcccacaccatgcgattcacgacgcc
gacgctggtggcgaaaacgcaaagcacatcaacgaagtcgaggaggtcacaacggccctc
gccgacgccgtcgccgatgcgctttcggatgaggttacgccgctcgttctcggcggcgac
cactctatcgccatcgggtcgatggtcggaagcgcccgcgacgccgatatcggcgtcgtc
tggttcgacgctcacggcgacttcaacacgcccgaaacctcgccatcggggaacgttcac
ggcatgcctcttgccgccgcgctcggcatcggtgacttcgagggcgtcgagtgggccaac
gccccgcgcctgaaagaagaaaacgtcgccatcgtcggcctccgcgacgtcgacgaaaac
gagaccacggcgattcaggacagcgacgtgaccgcctacacgatgtccgatatcgacgag
cgcggcatcaccgaagtgacgcaggacgctctcgatgtcgccacgaacggcaccgacggc
gttcacgtcagtctcgacctcgactggctcgaccccagagaggcacccggcgtcgggacg
cccgtccgcggcggtgtaacctaccgcgaggcgcacgcggcgatggaactcgtcgccgag
tcgggcgcgatgcgctcgctcgaacttgtcgaggtcaacccgatccttgatgaacacaac
gagacggccgcagtagcgaccgaactcgccgcaagcggtttcggaaagcgaattctctag

DBGET integrated database retrieval system