KEGG   Halogeometricum borinquense: Hbor_19250Help
Entry
Hbor_19250        CDS       T01359                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
hbo  Halogeometricum borinquense
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hbo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hbor_19250
   01230 Biosynthesis of amino acids
    Hbor_19250
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hbor_19250
   00051 Fructose and mannose metabolism
    Hbor_19250
   00562 Inositol phosphate metabolism
    Hbor_19250
Enzymes [BR:hbo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Hbor_19250
Exosome [BR:hbo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Hbor_19250
  Exosomal proteins of bladder cancer cells
   Hbor_19250
  Exosomal proteins of melanoma cells
   Hbor_19250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1852680..1853324)
Genome map
AA seq 214 aa AA seqDB search
MFILVNLKAYPCDPLEVATAAHEVAEESGVRIAVAPQAADVRRVADTGVETWAQHVDPNG
YGSHTGSTLAEAVAEAGADGTLINHSEKRLKLADIDGSVQAAARAGLETCVCANNPAQIG
AVAALGPDSVAVEPPELIGGDDSVATADPDIVRDAVEAAANVDESVEVFCGAGISSGDDV
DAAGDLGATGILLASGVAKADDPRAALEDLVEPL
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
gtgttcatcctcgtcaatctgaaggcgtatccgtgcgaccctctcgaagtagcgaccgcg
gcccacgaggtggccgaggaatccggcgtccgcatcgctgtcgcgccgcaggcggccgac
gtgcgtcgcgtcgccgacaccggtgtcgaaacgtgggcacaacacgttgatccgaacggt
tacggcagccacactggaagcacactcgccgaggcggtcgctgaggcgggtgcggacggc
acgctcatcaaccactccgagaagcgcctgaaactcgccgatatcgacgggtccgttcag
gccgcagcgcgcgctgggctggagacctgtgtctgcgcgaacaaccccgcacagatcggt
gccgtcgcagcactcgggccggactcggtggctgtcgagccgccggaactcatcggtggc
gacgactccgtggcgacggctgacccggatatcgtccgcgacgccgtcgaagcggccgcc
aacgtggacgaatctgttgaggtgttctgcggtgcaggcatctcctccggcgacgacgtt
gacgccgcgggcgacctcggcgcgacggggattctgctcgcgtccggcgtcgccaaggcc
gacgacccgcgtgcggcactcgaagacctcgtggaaccgctgtaa

DBGET integrated database retrieval system