KEGG   Halogeometricum borinquense: Hbor_19950Help
Entry
Hbor_19950        CDS       T01359                                 

Definition
(GenBank) acyl-CoA synthetase/AMP-acid ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hbo  Halogeometricum borinquense
Pathway
hbo00010  Glycolysis / Gluconeogenesis
hbo00620  Pyruvate metabolism
hbo00640  Propanoate metabolism
hbo00680  Methane metabolism
hbo00720  Carbon fixation pathways in prokaryotes
hbo01100  Metabolic pathways
hbo01110  Biosynthesis of secondary metabolites
hbo01120  Microbial metabolism in diverse environments
hbo01130  Biosynthesis of antibiotics
hbo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hbo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hbor_19950
   00620 Pyruvate metabolism
    Hbor_19950
   00640 Propanoate metabolism
    Hbor_19950
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Hbor_19950
   00680 Methane metabolism
    Hbor_19950
Enzymes [BR:hbo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Hbor_19950
Lipid biosynthesis proteins [BR:hbo01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Hbor_19950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADQ67561
UniProt: E4NNU7
Position
1909463..1911115
Genome map
AA seq 550 aa AA seqDB search
MVLSYDDAVSEFEWDIPADYNLPEVVTSHADSFGDRVAVRFRGADGVRDERTYADLRDDM
NRFANALAEMGVGKGDRVMHLVPRHPDVFAIQLGALKRGAILVPCSSMLKPKDIAYRAND
CEASTVVAHESLVEMVDEVREETPLERFISLGGAPQGWQSFSSLVDGREATHDGPELASS
DPMSINYTSGTTGQPKPVMHRHRWMRCFELVNAPYWWGVTAEGEVPPGETAEPADLDDEL
LWATTGTGWAKWFWSPVGVGITTGATQLLYDGEFDPETFLSIMAEEGVTRLCAVPTQYRM
FSQADLSEYDIDLRAALSAGEPLNREPIEAIESAFGVTPRDGYGQTETVALVTNYPGIEV
KPGSMGKPTPGLGTTIIDEDETELPPGEIGEIAVPVNCPGIFDGYYEREDLDEETFYGDY
YRTGDLASRDEDGFFFFEGRADDIIISAGYRIGPFEVEDALVSHEAVAEAAAVGSPHEER
GDVVKAYVVLTEGYDGSEELTNEIQEFMKEETAPYKYPRRVEFVDELPKTSSGKIRRIEL
RSREEELFGQ
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggtactatcatacgacgacgccgtcagcgagttcgaatgggacatcccggcggattac
aaccttcctgaggttgttacgtcgcacgccgactcgttcggcgaccgggtcgcagtccgc
ttccgtggcgcggacggagtgcgcgacgaacgaacgtacgccgacctgcgcgacgatatg
aaccgctttgccaacgccctcgcggagatgggtgtcggcaagggtgaccgcgtgatgcat
ctcgtcccgcgacacccggacgtgttcgccatccaactcggtgcgctgaagcgcggtgcg
attctcgtcccgtgttcgtcgatgctgaagccgaaggatatcgcctaccgagcgaacgac
tgcgaggcgtccaccgtcgtcgctcacgagagcctcgtcgagatggtagacgaggtgcgt
gaagagacgcccctcgaacgcttcatcagcctcggcggtgccccacagggctggcagtcg
ttcagttcgctcgtcgatggcagggaggcgactcacgacggtcccgaactcgcatcctcg
gatccgatgtctatcaactacacgtccggaacgacgggacagccaaagccagtgatgcac
cgccaccggtggatgcgatgtttcgaactcgtgaacgcgccgtactggtggggtgtcacc
gccgagggcgaggtaccgcccggtgagacggcagaacccgccgatttggacgacgaactt
ctctgggcgacgacgggcacagggtgggccaaatggttctggagtccggtcggcgtcgga
attacgacgggcgcgacgcagttgctctacgacggcgagttcgacccggaaacgttcctc
tcgatcatggcggaagagggcgttacacgcctgtgcgccgtcccgacgcagtaccggatg
ttctcgcaggccgacctctcagagtacgacatcgacttgcgcgccgccctctcggcaggt
gagccgctgaaccgtgaacccatcgaggccatcgagtccgccttcggcgtcacgccgcgc
gacgggtacggacagacggagaccgtggccctcgtgacgaactatcccggcatcgaggtc
aaaccggggagcatgggcaagccgacgcccggtctcgggacgaccataatcgacgaggac
gagacagaactccccccgggcgaaatcggtgagatagccgtccccgtgaactgcccgggt
atcttcgacggctactacgaacgcgaggacttggacgaggagacgttctacggcgactac
taccggacgggagatttggcctcacgcgacgaggacggctttttcttcttcgagggccgc
gccgacgacatcatcatctccgcgggctaccgcatcggcccgttcgaggtcgaagacgcg
cttgtctcccacgaggccgtcgcggaggcggccgccgtcgggtcgccccacgaggaacgc
ggcgacgtggtgaaagcgtacgtcgtcctgaccgagggatacgacggttccgaggagttg
acgaacgagattcaggagttcatgaaagaggagacggccccgtacaaatacccccgtcgg
gtggagttcgtcgatgaactgccgaagacatcttcggggaagattcgccgtatcgaactc
cggagcagagaggaggaactgtttgggcagtaa

DBGET integrated database retrieval system