KEGG   Halogeometricum borinquense: Hbor_20170Help
Entry
Hbor_20170        CDS       T01359                                 

Definition
chemotaxis response regulator containing a chey-like receiver domain and a methylesterase domain
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
hbo  Halogeometricum borinquense
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:hbo00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Hbor_20170
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Hbor_20170
Enzymes [BR:hbo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Hbor_20170
Two-component system [BR:hbo02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Hbor_20170
Bacterial motility proteins [BR:hbo02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Hbor_20170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1928998..1930161
Genome map
AA seq 387 aa AA seqDB search
MSTASGSNTADGTTRAVIVDDSRFMRTLIRTLLEDGGIDVVAEASDGAAAVETVTEHAPD
VVTMDIEMPEMNGIEAVEAIMEDCPTPVLMLSAHAEDDADVTFEALDKGAVDFVTKPGGE
VTSSMPSVKRELVEKVQSAAAVDLSATERTKGNVTTAPSRDSQTETATTQTDRSREREQT
TSPVSPESRLKRSFPDVSTLVIGASTGGPNVVEEVLGELPADANLRILVVQHMPEGFTRR
FADRLDTRSAYNVQEATDGEKIGAGEARVAPGGSHLVVDRDRRGQLTLKLTDTKPVHGVK
PAIDLTMASAVETVDGPLAGALLTGMGRDGVDGMGRIHEAGGHTVAQDEATSAIFGMPMR
AIETGCIEVVAPAEKVASSILDGLTED
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaccgcatcggggtcgaacacggcagacggcaccacgcgtgctgtcatcgttgac
gactcacgattcatgcggacactcattcgcaccctcctcgaagacgggggtatcgacgta
gtcgcagaggcgtctgacggggctgcagctgtcgaaactgtcacagaacacgctccggac
gtcgtgacgatggacatcgagatgcccgagatgaacggcatcgaggcggtcgaagccatc
atggaggactgtccgacgccggtgttgatgctctctgcacacgccgaagacgacgccgac
gtgacgttcgaggcgctcgataagggtgccgtcgatttcgtcacgaaaccgggtggggaa
gtaacctcctcgatgccgagcgtcaagcgcgaactcgtcgagaaggtccagtccgctgcc
gcagtggacctctcggcgaccgagcgaaccaagggtaacgtcactactgcgccctcgcgc
gacagtcagacggagacagcgacgacgcaaaccgaccggagccgcgagcgtgaacagaca
acctcgccggtgtctccggaatcacgactcaagcggtcgttccccgacgtatcgacgctc
gtcatcggcgcgtccacgggcggcccgaacgtcgtcgaagaagttctcggcgagttacca
gcggacgcgaacctccgcattctcgtcgtccaacacatgccggaagggttcactcgtcgg
tttgccgaccgcctcgacacgcggtcggcgtacaacgtccaggaggcgaccgacggtgag
aaaatcggcgctggcgaggcgcgcgtcgcgcccggcgggtcacatctcgttgttgaccga
gatcgcagaggccaactcacgctgaaactgacggataccaaaccggttcacggcgtcaag
ccggctatcgatctcacgatggcatcggccgtcgagaccgtcgatgggccgttggctggc
gctctcctcaccgggatgggacgcgacggcgtggacggcatgggccgaatccacgaggcg
ggcggacacacggtcgcacaggacgaagcaacgtcagcgattttcgggatgccgatgcgg
gcaatcgaaacggggtgcatcgaggtcgttgcccccgcggagaaagtcgcatcgagtatt
ctggacggactaacggaggactga

DBGET integrated database retrieval system