KEGG   Halogeometricum borinquense: Hbor_20640Help
Entry
Hbor_20640        CDS       T01359                                 

Definition
glycerophosphoryl diester phosphodiesterase
Orthology
K01126  
glycerophosphoryl diester phosphodiesterase [EC:3.1.4.46]
Organism
hbo  Halogeometricum borinquense
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:hbo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Hbor_20640
Enzymes [BR:hbo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.46  glycerophosphodiester phosphodiesterase
     Hbor_20640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1975623..1976522
Genome map
AA seq 299 aa AA seqDB search
MNDDGTTDPAIIAHRGFAGVYPENTVGAVGRATWGDDAEMVEIDIVPTADGKVVVFHDSE
LSGRDGGERGPTDLDGYVWDHSWEELQETEVLQSGETIPRLEQVFDAIPDDAGVNIEFKN
PGTTNVRFAEKLSAAELESQMEVWRPMAETALEIAADAENDVLVSSFHEAALAVVRDIDP
DVPIGCLFWDSIETGLAITREYDCEAIHPPYNMIQGTPFFEDEYYLSGPFADVDLVEVAH
EEGRTVNTWTIGTWYQAERLAEAGVDGLIADYPNLLWSAENTVDNDNDSDDTNDSDNDK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgacggaacgactgacccggcgataatcgctcaccgcgggttcgccggtgtg
taccccgagaacactgtcggtgcggtcggtcgagcaacgtggggtgacgacgctgagatg
gtcgagatagatattgtcccgacggccgacgggaaggtagtcgtcttccacgactcggaa
ctcagcggccgggatggtggcgaacgcggccccaccgaccttgatggctacgtttgggac
cactcgtgggaggaactgcaagagaccgaagtgctacagagcggtgagacgattccgcgt
ctcgaacaggtgttcgacgccatcccggacgacgcgggcgtcaacatcgagttcaagaat
ccgggaacgacgaacgtcaggttcgcagagaaactctctgcggcggaactcgaatcgcag
atggaagtgtggcggccgatggctgaaacagcgctcgaaatcgccgccgatgcagagaac
gacgttctcgtctcgtcgtttcacgaggcggcgctggccgtcgtccgcgatatcgacccc
gacgtacctatcgggtgtctgttctgggactctatcgagacgggacttgcgataacacgc
gaatacgactgcgaggcgattcacccgccgtacaacatgattcagggaacgccgttcttc
gaggacgagtactacctctcgggaccgttcgctgacgttgacctcgtcgaagtcgcacac
gaggagggtcgtacggtgaatacgtggaccatcggaacgtggtatcaggcagaacggctc
gccgaagcgggtgtagacggtctcatcgccgactatccgaatctgttgtggtccgctgag
aacacagtagacaacgacaacgacagcgacgacaccaacgacagcgacaacgacaaataa

DBGET integrated database retrieval system