KEGG   Halogeometricum borinquense: Hbor_21600Help
Entry
Hbor_21600        CDS       T01359                                 

Definition
amp phosphorylase (EC:2.4.2.-)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
hbo  Halogeometricum borinquense
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hbo00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Hbor_21600
Enzymes [BR:hbo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Hbor_21600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2065447..2066925)
Genome map
AA seq 492 aa AA seqDB search
MQLTTVDIDIGTRAPTVLMHGDDAATLGLHPLDRVQIETESETVVGIVELSNELVDTGEL
AVTRRLGHIDGTVEVTPAPRPSSVEFIRKKLDDDELEYDELDRIVRDIRDDRLSDVELGA
YVCAMYINGTSLSETMHLSESMADAGEKLSWEADIVADKHCVGGVSGNRTTPIIVSIVAA
AGVTIPKTSSRAVTSAAGTADTMEVFCPVDLSAKEIRTVVAETNGCIAWGGAVNLSPVDD
KIIRAETPLSLDPHGQLVASVLSKKQSAGSTHVLVDIPYGEGAKVGSLDEARELAHDFGR
VGDHLGMTIDCTITGGSAPIGRGVGPVLEARDVLSVLTGSGPGDLRRKSVRLAQILLDCV
GADADASEILESGRALDRFSAIVAAQGGDPDVLPSELVPGRYEQTVTAGRDGVVTHINNR
LVNDVARRAGAPRAPGSGLELHHSVGDAVAQGDPLYTIHAEASERLSEAATYAEDAEAVR
IRPPDETLVEQL
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgcaactcactaccgtcgatatcgatatcgggacgcgcgcgccgacggtcctgatgcat
ggtgacgacgccgccacgctcggactgcatccgctggatcgggttcagatcgagacggag
tcggagacggtagttgggattgtcgaactgagcaacgaactcgtagatactggcgagtta
gctgtcacgcgacgactcggacatatcgacggcaccgtcgaggtgacaccggctccgcga
ccctcgtcggtggagttcatccgcaagaaactggatgacgacgaactcgaatacgacgaa
ctcgaccgaatcgtccgcgacatccgcgacgaccgcctttcggacgtcgaactcggcgcg
tacgtctgtgcgatgtacatcaacggcacgtcgctgtcggagacgatgcatctctcagag
tcgatggctgacgcgggggagaagctctcgtgggaggcggacatcgttgccgacaaacac
tgcgtcggcggcgtcagcggcaaccgaaccacgccgattatcgtctctatcgtcgcggcg
gcgggcgttacgattccaaaaacatcctcgcgtgcggttacgtccgcggcgggcacggcg
gacacgatggaagtattctgtcccgtagacctttccgccaaggagattcggaccgtcgtc
gcagagacgaacggatgtatcgcatggggtggcgcggtcaacctctcgcccgtggacgac
aagatcatccgcgcagaaacaccgctttcgctggacccgcacggccaactcgtcgcgtcg
gtcctctcgaaaaaacagagcgcaggttcgacgcacgtcctcgtggacatcccctacggc
gagggtgcgaaagtggggagtttggacgaggcgcgcgaactcgcgcacgacttcggccgc
gtcggtgaccacctcgggatgaccatcgactgcacgatcaccggcgggagcgcaccgatc
ggtcgcggtgtcggtccggtgctggaagcccgggacgtactgtcggttctcactggcagc
ggtcccggtgatctcagacgcaagagcgttcgtctcgcgcagattcttctcgactgtgtc
ggggcggatgcggatgcgagcgagatactggagtccgggcgcgcgctcgaccggttcagc
gccatcgtagcggcacagggcggcgacccggacgtattgccgtctgaactcgtccccggc
cgctacgaacagacggtgactgcgggacgtgacggggttgtaacacacataaacaaccgt
ctggtcaacgatgtggcgcgtcgggcaggcgcgccgcgagcacccggttcgggattagaa
ctccaccacagcgtcggtgacgccgtcgcacagggtgacccactctatacgattcacgcc
gaggcgagcgaacgactctcagaggcggccacctacgctgaagacgccgaagccgtccgt
atccgcccaccggacgagacgctggtcgaacaactctga

DBGET integrated database retrieval system