KEGG   Halogeometricum borinquense: Hbor_22760Help
Entry
Hbor_22760        CDS       T01359                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
hbo  Halogeometricum borinquense
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hbo00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2175109..2177613
Genome map
AA seq 834 aa AA seqDB search
MQYHEAVRFLFDLRRFQVKPGTESVRSLLAEFDDPHEDVTFVQVAGSNGKGSTARMTESI
LREAGLTVGLYTSPHFETVRERARVDGRKIPESAICEFVERAKPWLVERAADGEPLTFFE
VVTALSIWYFAEAEVDVAVLEVGMGGKLDATSVVDPAAAAVTNVSLEHTAVLGDTIEAIA
EKKAAVEPADRPLVTGATGDALATIRDHTTTVVTVGTEDDADVTVRSEGRVNHQESAVAV
VADDWSVDSRIPLLGAYQAENAGIACVLARQITDELDSEIDETTLERGLRTAYWPGRFEV
METDPFVVLDGAHNPGACESVASVLDDFDVDALHLVFGAMHDKDQRKMVEALPDADSVIT
CRPNNPRSEDPETLAHVFEDAGVDDITVGDDVLSAVETARDRADADDCILAVGSLFLVAE
ARQAWTRTVTEATVRDRGDATALLERAHLSQSDLADAREESVHRTVSLSLQREQARTLQE
AMLRAGGNCVTSAESGSGELADVVLMGTLAAFDRLTTRLADAPDGLVGVAADVRKRVGLD
TADDRGSEATAPNGADSEEAPDDGYPWTDGPAVMGILNVTPDSFHDGGEFYDTDDALEQA
EAMIEAGADIIDVGGESTRPGAEEVPVEEEIRRIVPVLEALDDVDALLSVDTRKAAVAEA
ALDAGADILNDVTGLEDPEMRFLAAERDVPVIVMHSIDAPVVPGKDVDYDDVVGDVIDEL
RERILLAEKAGIPRENVIVDPGIGFGKSNAENFELLDRLGEFDALGCPLLFGHSHKSMFE
LVGSKAGDNLPATVAATALAADRGADIVRVHDVPENVTAVNVALAARDPDRFTE
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatcacgaggcggttcggttcctcttcgacctccgccggttccaggtcaaaccg
ggaaccgagtcggttcggtcgctcctcgccgagttcgacgacccccacgaggatgtgacg
ttcgtacaggtcgcggggtcgaacggcaaagggagtacggcgcgtatgaccgagtcgatc
ctccgcgaggctggactgacagtcggactctacacgtcgccgcacttcgagacggtccgc
gagcgcgcccgcgttgacgggcggaaaatccccgaatcggccatctgtgagttcgtcgaa
cgcgcgaagccgtggctggtcgaacgcgccgccgacggtgagccactgacgttcttcgag
gtggtgacggcactctcgatttggtactttgccgaggccgaagtcgatgtggccgttctc
gaagtcggcatgggtgggaaactcgacgcgacgagcgtcgttgatcccgccgccgccgca
gtgacgaacgtctcgctcgaacacaccgctgtactcggagataccatcgaagcgatagcc
gagaagaaagccgccgtcgaacccgcagaccggcctctcgtaacgggtgcgaccggcgac
gccttggccaccatccgcgaccacacgacgaccgtcgtcaccgtcggtaccgaggacgac
gccgacgtaaccgtccgctcggagggtcgcgtcaaccaccaagaatccgccgtcgcggtc
gtcgccgatgactggagcgtagatagcagaatcccacttctcggcgcgtatcaggccgaa
aacgcaggaatcgcgtgcgtactcgctcgacagattacggacgaactggattcggaaatc
gacgaaacgacgctcgaacgcggcctgcggaccgcttactggcccggtcggttcgaggta
atggagacggacccgttcgtcgtcctcgacggggcacacaatcccggtgcgtgcgaatca
gtcgcgtcggtcctcgatgatttcgacgtggacgcgctgcatctcgtcttcggcgcgatg
cacgacaaagaccagcggaagatggtcgaggcgctccccgatgcagactccgtgattacc
tgtcggccgaacaacccgcgttcggaggaccccgagacgctggcgcacgtgttcgaggat
gcgggcgtagacgacatcaccgtcggagacgacgttctctccgcagtcgaaacggcacgc
gaccgagccgatgcggacgactgcattctcgcagtcgggtcactctttctcgtcgccgag
gcgcgacaggcgtggacgcggacggtgacagaagcgacggtacgcgaccgaggcgacgca
accgcccttcttgaacgcgcacacctctcccagtcggatctcgccgacgcacgtgaggaa
agcgtccatcgaaccgtcagcctctcactccagcgagaacaggcccgaacactgcaagaa
gcgatgttgcgcgctggcggcaactgcgtcacaagcgccgagtccggaagcggtgaactc
gccgacgtggtgttgatgggaacgctcgcggcgttcgaccgcttgacgactcgactcgcg
gacgcaccggacggactcgtgggtgttgccgccgacgtgcggaaacgggtcggactcgat
accgccgacgacaggggcagcgaggctaccgccccgaacggcgctgacagcgaggaagcc
ccagacgacggttatccgtggacggacggacccgcggtgatgggaatcctgaacgttacg
ccggacagtttccatgacggtggcgagttctacgacacagacgacgctctcgaacaggcc
gaggcgatgatcgaggccggtgcagacatcatcgacgtgggcggtgaatctactcgaccg
ggcgcggaggaagtgcccgtcgaagaggagatacgacgaatcgttcccgtcttggaggcg
ctggacgacgttgacgccttgctctcggtggacacgcgcaaggcggccgtcgccgaagcg
gcgctcgatgcgggcgcggatatcctcaacgatgtgaccggtctcgaagaccccgagatg
cgattcctcgctgccgagcgcgacgttcccgtcatcgtgatgcacagtatcgacgcgccc
gtcgtccccggcaaggacgttgactacgacgacgtggttggggacgtaatagacgaactc
cgagagcgtattctgctggcggagaaggcaggcatcccccgagaaaacgtcatcgttgat
cccggtatcggcttcgggaaatcgaacgcggagaacttcgagctactggaccggcttggc
gagttcgacgcgctcgggtgcccgctcctgtttggccattcgcacaagtcgatgttcgaa
ctcgtcgggagtaaagcgggagacaacctccctgcgaccgtcgcggcgaccgcgctcgcg
gccgaccgcggcgcggacatcgtccgcgttcacgacgtgccggagaacgtcaccgccgtg
aacgttgccctcgcggcacgggacccagaccgctttaccgagtag

DBGET integrated database retrieval system