KEGG   Halogeometricum borinquense: Hbor_24280Help
Entry
Hbor_24280        CDS       T01359                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
hbo  Halogeometricum borinquense
Pathway
hbo00260  Glycine, serine and threonine metabolism
hbo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hbo01100  Metabolic pathways
hbo01110  Biosynthesis of secondary metabolites
hbo01130  Biosynthesis of antibiotics
hbo01230  Biosynthesis of amino acids
Module
hbo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hbo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hbor_24280
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hbor_24280
Enzymes [BR:hbo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Hbor_24280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB
Motif
Other DBs
NCBI-ProteinID: ADQ67986
UniProt: E4NRE5
Position
complement(2328180..2329064)
Genome map
AA seq 294 aa AA seqDB search
MGNPELDAAFENGAAFVPYLAAGDPDYESSIEYVEALERGGADVIELGLPFSEPIAEGPT
IQNAVVRSLESGMTPDRFFEFVEELDVDVPLVCMTYYNLIYRFGDESGPRPFVEKAAEVG
LSGFVVPDLPAEEADPLREACDEFGLDLVFIVAPTTQGDRLDRIMEQVSGYVYVQARLGV
TGAQDDVSGQTESSLERVAEYDIPKAVGFGIKTGDHAERIVAAGADGIIVGSALVDIVAE
GASAPRQMQSNDAAAHENGDDAETVAARLESKARELKDGAERGLAQRAPETERT
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggggaaccctgaacttgacgccgcgttcgagaacggcgcggcattcgtcccctatctc
gccgcgggcgacccggactacgagtcatcaatcgagtacgtcgaggcgctcgaacgcggc
ggcgcggacgtgatcgaactcgggcttccgttctccgaacccatcgcggagggaccgacg
attcagaacgccgtcgtgcgttcgctggagagcgggatgacacccgaccggttcttcgag
ttcgtcgaagaactggacgtggacgtaccgcttgtctgtatgacgtactataacctcatc
taccgattcggagacgagtccggaccgcggccgttcgtcgagaaggccgcagaagtcggt
ctgtcaggcttcgtcgtgccggacctacctgccgaggaggccgacccactgcgcgaggcg
tgcgacgagttcggtctggatctcgtgtttatcgtcgcaccgacgacgcagggtgacaga
ctcgaccgcatcatggaacaggtttcggggtacgtctacgtgcaggcacgtctcggtgtt
accggcgcgcaggacgacgtttccggacagactgaatcgagcctcgaacgggtagcggag
tacgacatcccgaaggccgtcggcttcggaatcaagaccggcgaccacgccgaacgtatc
gttgccgccggcgcggacggaatcatcgtcgggagcgcactcgtcgatatcgtcgccgaa
ggtgcttcggcaccccgtcagatgcagtctaacgatgcggcggctcacgagaacggcgac
gacgccgagacggtggccgctcgcctcgaatcgaaggcgcgcgagttgaaagacggggcg
gagcgaggattggcgcaacgtgcgcccgaaacggaacgcacataa

DBGET integrated database retrieval system