KEGG   Halogeometricum borinquense: Hbor_24290Help
Entry
Hbor_24290        CDS       T01359                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
hbo  Halogeometricum borinquense
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hbo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Hbor_24290
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hbor_24290
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hbor_24290
Enzymes [BR:hbo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Hbor_24290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2329066..2330313)
Genome map
AA seq 415 aa AA seqDB search
MSKTTFDGKFGEYGGQYVPEALMPAIEELEDAYERYVLENEDGFMDEFRRRLREFGGRPT
PTQYAERLSERYDCDVYMKREDLVHGGAHKLNNALGQVLLAKYMGKERIVAETGAGQHGT
ATAMAAAHLDMPCEVYMGERDINRQRPNVFRMRLNGSEVNPVTVGRGTLKEAISETMRDW
ATNVENTHYVIGSIVGPHPFPVMVRDFQSVISEEARKQMREQAGTLPDSVLACAGGGSNT
MGAFAEFVADEDVSLYAVEAGGSTLEVDEEAGVAPNSASLSTGSEGVLHGARTKLLQDRD
GQIMESHSVSSGLDYAGVGPELAHLVDEDRVLAVNIGDDDALTAFHRLSQLEGVIPALET
AHAFAYLEEHHEELGDTVLVNVSGRGDKDLESVIEETSKRDIDIAPDMDAFAGGF
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagacgacgttcgacggcaagtttggtgagtacggtggacagtacgttcccgag
gcgctcatgcccgctatcgaggaactcgaagatgcgtacgagcggtacgtgttggagaac
gaagacggattcatggacgagttccggcggcgactccgggagttcggcggccggccgacg
ccgacgcagtacgcagaacgtctctcggagcgatacgactgcgacgtgtacatgaagcgc
gaggacttggttcacggcggcgcacacaagctcaacaacgctctcgggcaagttctctta
gcgaagtacatgggcaaagagcgcatcgtcgctgagacgggcgcgggacaacacggaacg
gcgacggcgatggcggccgcccacctcgacatgccctgtgaggtgtatatgggcgaacgc
gacatcaaccgccagcgaccgaacgtcttccgaatgcgcctgaacggatcggaagtgaac
cccgtcaccgtcggccgtggaacgctgaaggaagcgatctccgagacgatgcgcgactgg
gcgacgaacgtcgaaaacacccactacgtcatcggaagcatcgtcggtccgcacccgttc
ccggtgatggtccgggacttccagtcggttatctccgaagaagcccgtaaacagatgcgc
gaacaggccggaacgcttccggactcggtgctcgcctgcgcgggcggcggatcgaacacg
atgggtgcgttcgcggagttcgttgcggatgaggacgtgtcgctgtacgccgtcgaagcg
ggcggttcgacgctcgaagtagacgaggaggcgggcgtcgcacccaactccgcgtcgctc
tcgaccgggtccgaaggcgtcctccacggcgcgcggacgaaactcctccaagatcgagac
ggacagattatggagagtcacagcgtctcctcgggtctcgactacgctggtgtcggtccc
gaactcgcccacctcgtggacgaggatcgtgtactggccgtgaacatcggcgacgacgac
gcgctcacggcattccatcgtctctcgcagttggagggagtcattcccgccttggagacg
gcgcacgcgtttgcctacctcgaagaacaccacgaggaactcggcgataccgtgctggtg
aacgtctccggtcgcggtgacaaggacctcgaatcggtcatcgaagaaacatcgaagcgg
gacatcgatatcgcgcctgacatggacgcgttcgcgggggggttctga

DBGET integrated database retrieval system