KEGG   Halogeometricum borinquense: Hbor_24300Help
Entry
Hbor_24300        CDS       T01359                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
hbo  Halogeometricum borinquense
Pathway
hbo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hbo01100  Metabolic pathways
hbo01110  Biosynthesis of secondary metabolites
hbo01130  Biosynthesis of antibiotics
hbo01230  Biosynthesis of amino acids
Module
hbo_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:hbo00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Hbor_24300
Enzymes [BR:hbo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Hbor_24300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS FMN_dh NanE QRPTase_C His_biosynth DHO_dh PcrB ThiG CW_binding_2
Motif
Other DBs
NCBI-ProteinID: ADQ67988
UniProt: E4NRE7
Position
complement(2330310..2331092)
Genome map
AA seq 260 aa AA seqDB search
MNASEDSLAPEVRSILDAARERPGGDEPVAVTARSFPDAVAATEAAGRIPVVAEVKPTSP
TTAGERTDDPVELAREMVAGGATALSVLTEPDHFGGSVESLRRIREAVDVPVLRKDFVVN
ESQLDAVESDLVLLIARFLGDDLSDLVTAAKERGFQPLVEVHDRDELGRALDAGADIIGV
NNRDLATLAVDLETFESVAPHVPDDVTLLAESGVTSAEDARRMRAAGADALLIGTAIMDG
DVRANTDRFSNATAKTELSE
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaacgctagtgaggattcactcgcgcccgaggttcgttcgatcctcgatgccgcgcga
gagcgacccggcggcgacgaacccgtcgccgtgacggcgcggtcgttccctgatgccgtc
gccgcgaccgaagccgcgggtcgcatccccgtcgttgcagaggtcaagcccaccagtccg
acgacagcaggcgagcggaccgacgatccggtcgaattggctcgcgagatggtcgccggc
ggtgcgactgcactctcggtcctgaccgaacccgaccatttcggcgggtcagtcgaaagc
cttcgacgcatccgcgaagccgtcgatgttcccgtgcttcgcaaggatttcgtcgtgaac
gagtcacagttggacgccgtcgagtccgatctcgttctccttatcgcgcgatttctcgga
gacgacctttcggacctcgtgacggccgcaaaagagcgaggtttccaaccgctcgtcgag
gttcacgaccgcgacgaactcggccgcgcactcgacgccggtgccgacatcatcggcgtg
aacaaccgcgacttggcgacgttggcggtcgatctcgaaacgttcgaatccgtcgctccc
cacgtccctgacgacgtgacgcttctggccgagagcggcgtgacgagcgccgaagatgcc
cggcggatgcgcgcggcgggtgcggacgctcttctcatcgggacggcaatcatggacggc
gacgtgcgcgcgaacacggaccgattcagcaacgcgacagcgaagacggagctatcagaa
tga

DBGET integrated database retrieval system