KEGG   Halogeometricum borinquense: Hbor_26060Help
Entry
Hbor_26060        CDS       T01359                                 

Definition
aldehyde:ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
hbo  Halogeometricum borinquense
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:hbo01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:hbo00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2490723..2492543)
Genome map
AA seq 606 aa AA seqDB search
MSDTALRKRTRLLRVDLSDGTVTHDSLPAEWRRQFVGGKGLAARLLYEKLDPGTDPLSPS
NVVILALGPLSGIAPGEDRFAVVTKSPLSGTFLDSYAGGSFPPTLAGALPDHLLVAIEGQ
ADEPTRLVIEDGDARLERSDCWGLDTVETDDRVDGAVACIGPAGENLVRYATLASDGGDH
HAGRGGVGAVFGSKQLKSVVARGDPPTSTPELESLREAHRERFSREGPGEWLRAGGTLET
IDFADEMGVLPTRGWESGSFDGVDDVGIEAVQAAAVAREYDDVSVVSDGRGDFRIEVSDE
QKPESVPRGAAPISLGAGLAIDDFDAVATLGATCDRLGVDVISAGTAVAWAMRAADEGLL
ERDLSFGDAASAQALVSRIARRDGELADTLADGVDAAANRFGNDERRSHTSAQQTPSGDG
DSLVPTVKSMALPSYDPRGSPAMALAYATSDRGACHRRARPVVEEVFATEEWSPERRAAA
VAEEQITRAVLWSLVVDDFAGEVIRDYGASWLSAVGLDYTPAELRRVGERVWTLTRLFNV
REGFDRDDDALPDILTRPQVQGGHDGLDREAFERTLDAYYDRLGWDEDGRPTPDLCERLG
IDNLRP
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatacggccctccgcaagcgaactcgtctcctccgcgtagacctctccgacggg
acggtcacacacgattccctccccgccgagtggcgtcggcagttcgtcggcggtaaggga
ctcgctgcccgactcctctatgagaagctcgacccgggtaccgacccgctttcgccgtcg
aatgtggtgatcctcgcactcggaccactctccggcatcgcccccggtgaggaccgtttt
gccgtcgtcacgaaatcgccgctctcgggcacgtttctcgactcttacgccggtgggtcg
ttcccgccaacgcttgccggcgcacttcctgaccacctcctcgtcgctatcgagggacag
gcggacgaaccgaccagactcgtgatcgaggacggcgatgcccgtctcgaacggagcgat
tgctggggactcgacaccgtggagaccgacgaccgcgtggacggcgcagtcgcctgcatc
ggccctgcgggtgagaatctggtacggtacgccacgctcgcctcggacggtggcgaccac
cacgccggacgcggcggcgtcggggccgtcttcggatcgaagcaactgaaatcggttgtc
gctcgtggtgacccgcccacatcgacgccggaacttgagtctctccgcgaggcacaccgc
gaacgcttctcgcgtgaggggccgggcgagtggcttcgtgcgggcgggacgctggagacg
atagacttcgccgacgagatgggcgttctcccgacgcgcgggtgggagtccgggtcgttc
gacggcgtggacgacgtgggaatcgaggcggttcaggcggccgctgtcgcccgcgaatac
gacgatgtgagcgtcgtgagcgacggacgcggcgactttcgtatcgaagtctccgatgag
cagaaacccgaatccgtgccgcgaggggccgcaccaatctcgctgggtgcgggtctcgct
atcgacgatttcgacgctgtggcgacgctcggagcgacatgcgaccgtctcggtgtggac
gtaatcagcgccggtaccgccgtcgcgtgggcgatgcgagcggccgacgaagggctcctc
gaacgcgacctgtcgttcggtgatgcggcgtcggcacaagcactcgtttcacgtatcgct
cgccgcgatggtgaactcgcagatacactcgcggacggtgtggacgcggcggccaaccgt
ttcggaaacgacgagcgacgttcacatacgtcggctcagcagacaccgtctggtgatggc
gatagtctcgttccgacggtaaagtcgatggcactcccgtcgtacgacccgcgcgggtcg
ccagcgatggcactcgcttacgcgactagcgaccggggagcgtgtcaccgccgcgctcgc
cccgtcgttgaggaggtgtttgccaccgaggagtggtcgccggaacgccgcgcggcggcc
gtcgccgaagaacagatcacgcgggcggtgctgtggtcgctggtcgttgatgacttcgcg
ggcgaggtgatccgtgattacggtgcgtcgtggctctctgccgtcggtctcgactacacg
ccggcggaacttcgtcgcgtcggcgaacgagtgtggacgctcactcgcctgttcaacgtc
cgcgagggattcgaccgtgacgacgatgcgctgcccgacatactcacccgcccgcaagtg
cagggcgggcacgacggactggaccgcgaggcgttcgagcggacgttggatgcctactac
gaccgtcttgggtgggatgaagacgggcggccgacgccagacctgtgcgagcggttgggg
atcgataatttgcggccctga

DBGET integrated database retrieval system