KEGG   Halogeometricum borinquense: Hbor_26920Help
Entry
Hbor_26920        CDS       T01359                                 

Definition
l-threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
hbo  Halogeometricum borinquense
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:hbo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Hbor_26920
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Hbor_26920
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Hbor_26920
Enzymes [BR:hbo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Hbor_26920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2579055..2580146
Genome map
AA seq 363 aa AA seqDB search
MSLSNLSLRCSACGETYETAWAWRCDCGAPLDFLADARPSRSAPDPREFDDRRGLWSFAD
FLPVGPHVTLGEGMTPLVDAPEWDAAFKLEYVFPTGSFKDRGATTTLSVATELGIEKVVE
DSSGNAGAAIATYAARAGIDADIYVPASVKAAKLRAIERAGATPVRVEGSREDVTDACLE
AVEDGDGWYASHAWNPAFFAGTATFAYEVAYQRGWSAPDAVVTPLGHGTLFLGAYRGFRA
LRDAGWIDEMPKLLGAQAAGYAPVAEELHGPTEGTNDVADGIQIRDPTRLDQILDAVDAT
DGDAIALTEDAVETELDRLHRRGFYTEPTCAVAPAALGEYRERGVLSDDDDVVVPLTGSG
LKN
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgtccctctcgaacctctctctgcggtgttccgcgtgcggtgagacgtacgaaacggcg
tgggcgtggcggtgtgactgcggcgcgccgttggactttcttgcggacgcccgtccgtcg
cgcagtgcgccggaccctcgcgagttcgacgaccggcgcggtctctggtcgttcgctgac
ttcctccccgtcggcccgcacgtcaccctcggcgaagggatgaccccgttggttgacgct
cccgagtgggatgccgcgttcaaactggagtacgtcttcccgacagggtcgttcaaggac
cgcggggcgacgacaacactctcagtcgcgacggaactcggcatcgagaaagtggtcgaa
gactcctcgggcaacgcgggggcggccatcgctacctacgccgcccgggccggtatcgac
gccgacatctacgttcctgcgtcggtgaaagccgcgaaactccgcgccatcgagcgcgcc
ggagccacgcccgtccgtgtggaaggctcccgcgaggacgtgactgacgcctgtctcgaa
gcggtcgaagacggcgacggatggtacgcctctcacgcgtggaatccggcgttcttcgcc
gggacggcaacgtttgcctacgaggtggcctaccagcgcggatggtccgctcccgacgcg
gtcgtcacgccactcggccacggaacgctgttcctcggcgcataccgcggcttccgcgca
ctccgcgacgcgggttggatcgacgagatgccgaaactgctcggcgcgcaagcggccggg
tacgcgcccgtcgcggaggaactgcacggtccaaccgagggaacaaacgatgtcgccgac
ggcatccagatacgtgatccgacgcgtctcgaccagattctcgacgccgtggacgcgacc
gatggcgacgccatcgcactcacagaagatgcggtggagacggaactcgaccgcctgcac
cgacgcggattctacacggaaccgacgtgtgccgtcgcacccgctgcactcggcgagtac
cgcgaacgcggggttctctcggatgacgacgacgtggtcgttccgctcacagggagcgga
ctgaagaactga

DBGET integrated database retrieval system