KEGG   Halogeometricum borinquense: Hbor_26940Help
Entry
Hbor_26940        CDS       T01359                                 

Definition
protein-l-isoaspartate carboxylmethyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
hbo  Halogeometricum borinquense
Brite
Enzymes [BR:hbo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Hbor_26940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2580588..2581343)
Genome map
AA seq 251 aa AA seqDB search
MDPAVLREDMVDGLEHGMDVAESVALAMRTVPRHEFVEDAPYQNRASKFEGSTVLSPANV
ARLLTALSAEPDEDVLIVGAGVGYTAALVAEIVGDTHVHAVDIDRRLVYAARSNLQSVES
AAVLVDCRDGADGLPEYAPFDRILVEAAAIEPPNRLVSQLEPDGRLVFPMGGPKQTLVSV
DAAGEVVEKHGPVAFDPLLVEGEQRSGPVRNRTVREDAEFSDSGYFAPSGWEQEWIDWDE
RLSGRQRRYER
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggaccctgcggtactgcgtgaggacatggttgatggcctcgaacacggaatggacgtg
gccgaatccgttgccctcgccatgcgaaccgtcccgcgacacgagttcgtcgaggacgcc
ccgtaccaaaaccgcgctagcaagttcgagggttcgaccgttctctctccagcgaacgtc
gctcgactgctcactgcgctctcggcagaaccggacgaagacgtgctgatcgtcggtgcc
ggagtcggatataccgccgcactggtagccgaaatcgtcggtgacacgcacgttcacgcg
gtcgatatcgaccgtagactggtctatgcggcacggtcaaatctccaatccgtggagtcg
gccgccgtcctcgtagactgtcgtgatggcgcggatggactcccggagtacgcgccgttt
gaccgtatcctcgtcgaagcggcggccatcgaaccgccgaaccgactcgtctcgcaactc
gaacccgacggccgactcgtcttcccgatgggcgggccgaagcagacgctcgtgagcgtc
gatgccgcgggcgaagtcgtcgaaaagcacggacccgtcgcgttcgacccgctgttggtc
gaaggcgaacagcggagcggacctgtccgaaaccggacagtccgcgaggatgccgaattc
agtgactctgggtacttcgcacccagcggatgggaacaggagtggatcgattgggacgag
cgactcagcggccggcagcgtcgatacgagcgctga

DBGET integrated database retrieval system