KEGG   Halogeometricum borinquense: Hbor_26990Help
Entry
Hbor_26990        CDS       T01359                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
hbo  Halogeometricum borinquense
Pathway
hbo00010  Glycolysis / Gluconeogenesis
hbo01100  Metabolic pathways
hbo01110  Biosynthesis of secondary metabolites
hbo01120  Microbial metabolism in diverse environments
hbo01130  Biosynthesis of antibiotics
hbo01200  Carbon metabolism
hbo01230  Biosynthesis of amino acids
Module
hbo_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:hbo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hbor_26990
Enzymes [BR:hbo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Hbor_26990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N NAD_binding_3 2-Hacid_dh_C Sacchrp_dh_NADP Semialdhyde_dh DUF4143
Motif
Other DBs
NCBI-ProteinID: ADQ68246
UniProt: E4NTU1
Position
2585142..2586218
Genome map
AA seq 358 aa AA seqDB search
MGVNGYGTIGKRVADAVDAQPDMEVIGVAKTQPNFEAHTAVKRGYPMYAAIPERMPLFSE
AGIDVEGAVDEMVADADIVVDCTPSGIGAENKALYESHDTPAIFQGGEDADVGEVSFNAR
ANYDDARGVDYVRTVSCNTTGLSRIIAPLREEYGVEKVRATLVRRGGDPGQNSRGPINDI
LPNPISIPSHHGPDVNTIFPDLAIDTLGLKVPATLMHVHSLNVTLEDDVTAAHVRQLLES
ESRVYVIPEGLGIDGAGKLKDFALDAGRPRGDLWENCVWGESIAVEGRDLYLFQAIHQES
DVIPENVDAIRAMTESVDQAESMVTTDDYLGVGITGDPSGFSNEDEAEAVTETEIADD
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
gtgggtgtcaacggctacggcacaattggaaaacgtgtcgctgacgccgtggacgcacaa
cctgacatggaagtcatcggtgtggcgaaaacccagccgaacttcgaggcccacaccgcc
gtcaaacgcgggtacccgatgtacgccgcaatccccgaacggatgcccctgttctcggaa
gcgggcatcgatgtcgagggtgccgtcgacgagatggtggctgacgccgacatcgtcgtg
gactgtacgccgtcgggcatcggcgcggagaacaaagcactctacgaatcgcacgacacg
cccgccatcttccaaggcggcgaagacgccgacgtgggcgaggtgagcttcaacgcccgc
gcgaactacgacgacgcacggggcgtagactacgtccgaaccgtctcctgtaacacgacc
ggtctctcgcgcattatcgcacccctgcgcgaggaatacggcgtcgagaaggtgcgcgcg
acgctggtccgccgcggtggcgaccccggacagaactcccgtggcccgatcaacgacatt
ctcccgaacccgatttcgattccgagtcaccacgggccggacgtgaacacgattttcccc
gacctcgctatcgatacgctcggactgaaagtgcctgcaacgctgatgcacgtccacagc
ctcaacgtcacgctcgaagacgacgtgacggcagcgcacgtccggcaactcctcgaatcg
gaatcgcgcgtctacgtcattcccgaaggactcggcatcgacggcgcagggaaactcaaa
gacttcgcgctcgacgcgggccgcccgcgcggtgacctctgggagaactgcgtctggggc
gagtcgatcgccgtcgaaggccgcgacctgtacctgttccaggcgattcaccaggaatcc
gacgtgatccccgagaacgttgacgccattcgcgcgatgacggagtcggtcgatcaggcc
gaaagcatggtgacgacggatgattacctcggcgtcggtatcacgggtgatccgtcgggt
tttagcaacgaggacgaggccgaagcagtcaccgagacggaaatcgccgacgactaa

DBGET integrated database retrieval system