KEGG   Halogeometricum borinquense: Hbor_30430Help
Entry
Hbor_30430        CDS       T01359                                 

Definition
nitrous oxide reductase apoprotein
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
hbo  Halogeometricum borinquense
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:hbo00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Hbor_30430
Enzymes [BR:hbo01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     Hbor_30430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pHBOR01:79699..81717
Genome map
AA seq 672 aa AA seqDB search
MSSHDTSEGEETDTKTERSAETLLSEHEAQLNALIADVQGPDADPVETQLPNLGLGLGRR
DFMKAGAAVGVLGSVAGCAGQGDSQGGTATPSSSHGDVPDHFVPPGEHDKYYGFWSGGHS
GEVRVMGIPSMRELTRIPVFNRECAKGYGFDDGTGEMLKDAGDYTWGDSHHPSLSETDGK
YDGEYLFVNDKANGRVARVNLKYFETDAILDVPNVQSVHGCCIQSPDTEYVFANGEFRAP
LPNDGRDVDDPSKYVSLFSAIDPESMDVLWQVKVSGNLDIADSDKDGRWLLSSSYNDEEG
VEIEEMTRDDRDSVKAFDVPAIQKAVDAGKYEEVNGVPVVDGTRESSLNKGDNPLVRYIP
TPKSPHCVEVTPDGKYGIVAGKLSPTVSIIDIEKLGTEPDPAKTIVGQPKLGLGPLHTTY
DDRGHGYTSLFIDSQVVKWDIEKAVESPKGSEEAILGKIDVHYNPGHIQAVQAMSVEPTG
DWLVVLNKLSKDRFLPVGPIHPDNDQLIYIGNDKDNETGGMELVSDHPVYPEPHDAIMVH
KDKLDPAKIWDAKDYEGEREYISEKNSGIERLDDSTVEVNMSSKRSEFGLREFTVKEGDE
VQMTVTNIEKSPDIIHGVAIPEHDINLALAPQDTREVTFAADDPGVYWIYCTYFCSALHL
EMRSRMIVEPRD
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgagttcacacgacacatcggagggggaggagaccgacaccaaaacagagcgtagcgca
gagacattactatcggaacacgaggcgcagttgaatgcgcttattgcagacgtacagggg
ccggacgcggacccagtagagacgcaacttccgaatctcggtcttggtctcggtcgccgg
gacttcatgaaagcgggggcagccgtcggggttctgggctccgtcgccgggtgtgcaggg
cagggcgacagccagggtggtacagccacgccgtcttcgagtcacggcgatgtgcccgac
cacttcgttccgccgggcgaacacgacaagtactacggcttctggagtggcggtcactcc
ggcgaagtgagagtaatgggaattccgtcgatgcgggaactcacgcgaatccccgtgttc
aacagggagtgcgcgaagggatacggtttcgacgacggaacgggggagatgcttaaagac
gcaggcgactacacgtggggtgactctcaccacccgagcttatccgagaccgatgggaag
tacgacggcgagtacctattcgtcaacgacaaagccaacggccgcgtcgcacgggtgaat
ctgaagtacttcgagacggatgcgattctggacgtgccgaacgtccagtcagtccacgga
tgctgcattcagagccccgacaccgagtacgtcttcgccaacggtgagttccgtgcgccg
cttccaaacgacgggcgcgacgtagacgacccgtcgaagtacgtctcgctgttttcggcc
atcgaccccgaaagcatggacgtactctggcaggtgaaagtcagcggcaacctcgacatc
gccgactccgacaaagacggccggtggctgctctcgtcgtcgtacaacgacgaagagggg
gtcgaaatcgaggagatgacccgcgacgaccgcgactcggtgaaggcgttcgacgtacca
gccattcagaaagcggttgatgccgggaagtacgaggaggtcaacggcgtccccgtcgtc
gatgggacccgtgaaagttcactcaacaagggcgataacccactcgtccgctacatcccg
acgccgaaatcaccccactgcgttgaggtgacgccggacggaaagtacggcatcgtcgcc
ggaaagctctctccgaccgtctcgatcatcgatatcgagaaactcggaaccgaacccgac
ccggcgaagacgattgtcggccagcccaaactcggtctcggtccactgcacactacgtac
gacgaccgcggtcacgggtacacctcgctgttcatcgactcgcaggtcgtcaagtgggat
atcgaaaaggcagtggagtcaccaaaaggctccgaggaggccattctcgggaagatagac
gtccactacaacccaggacacatccaagcggtacaggcaatgtccgtcgaaccgaccggc
gattggctcgtcgtcctcaacaaactgtcgaaggaccggttcctcccagtcggaccgatt
caccccgacaacgaccaactcatctacatcggaaacgacaaagacaacgaaaccggtgga
atggaactggtttccgatcaccccgtctatcccgaaccgcacgacgccatcatggtccac
aaagacaagttggacccggcgaagatatgggatgccaaggactacgagggagaacgggag
tacatctccgagaagaactcgggaatcgaacgcctcgacgactcgaccgtcgaggtgaac
atgagttccaagcggagcgagttcggcctccgtgaattcacggtgaaagaaggcgacgaa
gtgcagatgaccgtgacgaacatcgagaagagtccggacatcatccacggagttgccatc
cccgaacacgacatcaacctcgcgctcgccccacaggacactcgggaagtaacgttcgcc
gcggatgatcccggcgtctactggatctactgcacgtacttctgtagcgcactgcaccta
gagatgcgctcgcggatgatcgtcgaaccacgggactga

DBGET integrated database retrieval system