KEGG   Halogeometricum borinquense: Hbor_32150Help
Entry
Hbor_32150        CDS       T01359                                 

Definition
(RefSeq) acyl-CoA synthetase/AMP-acid ligase
  KO
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
hbo  Halogeometricum borinquense
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hbo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hbor_32150
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hbor_32150
   00620 Pyruvate metabolism
    Hbor_32150
   00640 Propanoate metabolism
    Hbor_32150
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Hbor_32150
   00680 Methane metabolism
    Hbor_32150
Enzymes [BR:hbo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Hbor_32150
Lipid biosynthesis proteins [BR:hbo01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Hbor_32150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pHBOR01:281419..283101
Genome map
AA seq 560 aa AA seqDB search
MSNGHNLVDYETEREAFSWDDIYAEADWDAPEKLNIAHEVVDRHATDRERVALYQVDTDG
ELTKMTFWELADRSSQFANVLDRLGVEQGDRVFSYMPRIPEHYVALIGTLKHGAVWGSVN
ERFGPDGIAYRLDDCDAKVVVTTTDNRETVADALDDAPAVEHVITVDRGGGAPVEDVVFN
TALDGASKEYEAAETGGEDNALLYYTSGTTGLAKGVLHKQRWVAGVAATQKYAVDLQPGD
LYWSTGDLGWLTGAINTLGAWFWGTSLFTYEGEFDPTEWADLLDEFPVTVLFSVPTAYRM
LREKEDVLDDVDLDLRHALSIGEPLSAGVVEWGKENLGVTILDTYGQTETGNMIINNYPT
MELRPGSMGKPLPGIEADIVDPDTGEVLPPGETGEIAERGDYPCFFAEYWNKPEKTAACF
VEGDSGEWYLSGDLAYKDEDGYFWFEGRADDVILSSGYRIGPFEVESSLGEHEAVAESAV
VPKPHPERGNIVKAYVVLSEGTEPSESLKEDIKNKVKSDLSAHEYPREIEFRDELPKTVT
GKIRRTELQDEAENETETSS
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatggtcacaatttggtcgattacgaaacggaacgcgaggcgttttcgtgggac
gacatctacgccgaggcagactgggatgcacccgagaaactgaacatcgcacacgaggtc
gttgatcgacatgcgactgaccgcgaacgggtcgcgctctatcaagtagacaccgacggg
gaactcaccaagatgacgttctgggagttggcagaccgatcaagccagttcgcaaacgtt
ctcgacagactcggcgtcgaacaaggcgaccgcgtcttctcgtacatgccccgaattccc
gaacattacgtcgctttaatcgggacactcaaacacggcgctgtctgggggagcgtcaac
gagcggttcggtcccgacggaatcgcatatcgacttgatgactgtgatgcgaaggttgtc
gtcactacgactgacaaccgcgagacagtcgctgacgcactggacgatgcacccgcagtt
gagcacgtcattactgtggaccgtggtggcggtgcgcctgtcgaggatgtcgtcttcaac
accgcgctcgatggcgcgagcaaggagtacgaagccgccgaaaccggcggcgaggacaac
gcactgctgtactatacctcggggacgacaggtctggcaaaaggcgtcctccacaaacag
cgttgggtggctggcgtcgcggcgacccaaaagtacgccgttgatctccaaccgggtgac
ctctactggagtaccggcgatctgggctggctaacgggcgctatcaacacgctgggtgct
tggttctgggggacttcgctgtttacctatgaaggcgagttcgatcccacggagtgggcc
gatctactcgacgagtttcccgtcaccgtcctgttctcggttccgacagcctaccggatg
cttcgggagaaagaggacgtactggacgatgtcgatctcgacctgcgtcacgcgctctct
atcggagaaccgctcagcgccggtgttgtcgagtggggcaaagagaatctcggcgtcacg
attctcgacacgtacggccagaccgagaccgggaacatgatcatcaacaactacccgacg
atggaactccgccccgggtcgatggggaaaccgctccccggcatcgaagccgacatcgtt
gaccccgataccggcgaggtgttgccgccgggtgagacaggggaaattgccgaacgcggc
gactatccgtgtttcttcgccgagtactggaacaaaccggagaagacggcggcgtgcttc
gtcgaaggcgacagcggtgaatggtatctctccggtgaccttgcatacaaagacgaagac
ggatacttctggttcgaggggcgcgcagatgacgtgatcctctcgtcggggtaccgcatc
ggtccgttcgaagtcgaaagttcgttgggcgaacacgaagcggtcgcggagtcggccgtg
gtcccgaaaccgcatcccgagcggggtaacatcgtgaaggcgtatgtcgtccttagcgag
ggaaccgagccctcagagagcctcaaagaggacatcaagaacaaggtcaagtcggacctc
tcggcccacgagtacccgcgcgaaatcgagttccgcgacgaactcccgaaaacggtaacc
ggaaagattcgccgaaccgaactgcaggacgaagccgaaaacgagacagaaacgtcgtcc
tga

DBGET integrated database retrieval system