KEGG   Halogeometricum borinquense: Hbor_32220Help
Entry
Hbor_32220        CDS       T01359                                 

Definition
dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
hbo  Halogeometricum borinquense
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hbo00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Hbor_32220
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Hbor_32220
Enzymes [BR:hbo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Hbor_32220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pHBOR01:293885..294745
Genome map
AA seq 286 aa AA seqDB search
MPHEFDLTEPELTADDLLVLEDPHFGPETTAVVTGAASGIGQATAVALAANGLSVIGADI
DDDGLTETVDLADDIAVAGTIHPVTTDLTDDADVEAMIEVAADQGELRYVANIAGMQHIA
SIPEFPMEKYDFIVDIMLRAPFLTAKLAMPHIRATDDGVGAIANMSSVHGHYATQDKPAY
ITAKHGLEGLTRAIAAEGEGTLRGFSVSVGYVLTPLMVNQIEGTADERGISKREVVEDVM
LGQARTKEMMTPAEVANLFVFGFSGHGKHLNGGDMLWDGGYTTTYE
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgccacacgagttcgacctcaccgaaccggaactgactgccgacgatctgctcgttctg
gaggatccgcacttcggtcccgagaccacggccgtcgtgaccggtgctgcgtcgggcatc
ggacaagcgactgccgtcgcgctcgcagcaaacgggctctccgtcatcggtgccgatatc
gacgacgatggtctcacagagacagttgacctcgctgatgacatcgctgtggcggggacg
atacatccagtgacgaccgacctcactgacgacgccgacgtggaggcgatgatcgaggtt
gcggccgatcagggagagcttcgatacgttgcgaacatcgccggaatgcaacatatcgcg
tcgattccggagttccctatggagaagtacgatttcatcgtagacatcatgttgcgcgcc
ccgtttttgaccgcgaaactagcgatgccgcacatccgcgcgactgacgacggtgtcggc
gctatcgcgaacatgtcctcggtacacggccactacgcgactcaggacaaacccgcgtat
atcactgcaaaacacggtctcgaaggactcacccgcgctatcgctgccgagggcgaaggg
acccttcgaggattctcagtcagcgtcggatacgttctcactccgctcatggtgaatcaa
atcgaaggtacggccgacgaacgaggcatctccaaacgcgaggtcgtcgaggacgtgatg
ctcgggcaggcccgcacgaaggagatgatgactcccgccgaggtggcaaacctcttcgtg
ttcggtttctccggacacggcaagcacctcaacggcggcgatatgctttgggacggcggc
tacacgacgacctatgagtga

DBGET integrated database retrieval system