KEGG   Halogeometricum borinquense: Hbor_34590Help
Entry
Hbor_34590        CDS       T01359                                 

Definition
sugar kinase, ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
hbo  Halogeometricum borinquense
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:hbo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Hbor_34590
Enzymes [BR:hbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Hbor_34590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pHBOR02:183828..184760
Genome map
AA seq 310 aa AA seqDB search
MGRVVSLGSINVDHVGYTSTEWIRSTAASYDWFPSPGETVRVESFPDSLAQAYDERYLGG
KGANQAVAAAAAGADTSLLGMVGEDESEYEVRTTLSKRGVDVTEVESTDGPTGAAYVAVD
ETGENYIAILAGANGRVDDAYVERHVGSLTSADCLLVQNELPAETVRAALDHLAERDNRP
TVVYDPAPAADATTILTHDCVDVVTPNRGEYETLRDDIEAFDGIVVRTRGAEGVVVEGED
RFTVPSPSVEPIDTTGAGDVFAGFLGAELAAGSDLEQAVRLATVAGAVSTEREGVQAAVP
SRKVVESATV
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgggccgtgtcgtgagtctcgggagcatcaacgtcgatcacgtcggatacacgtctacg
gagtggattcgctcgacggcggcgtcatacgactggttcccgtcgccgggcgagacagtg
cgagtggagtcgtttcccgactccctcgctcaagcgtacgacgagcgatacctcggtggc
aagggcgcgaatcaggcagtcgcggcggcggccgccggtgccgatacttcgcttttagga
atggttggcgaggacgaatccgagtacgaggtccgtacgacgctctcgaaacggggagtc
gatgtgaccgaggtcgaatcgaccgacgggccgaccggcgcggcgtacgtcgccgtagac
gagaccggtgagaactacatcgctatcctcgctggagcgaacggccgcgtagacgacgcg
tacgtcgaacggcacgtcgggtctctcaccagcgccgactgcttactcgtacagaacgaa
ctcccggctgagacggttcgtgccgcgcttgatcacctcgccgaacgtgataatcgcccg
acggtcgtctacgaccctgcacctgccgcggatgcgacgacgattctcacacacgactgc
gtggacgtggtgacgccgaatcggggagagtacgagacgcttcgggacgatatcgaagcg
ttcgacggtattgtcgtcagaactcgtggagcggaaggcgtcgtcgtggagggtgaggac
cgatttactgttccatcgccgtcggtcgaaccgatagatacgaccggcgcgggcgacgtg
ttcgccggtttcctcggggcggaactcgcggccgggtcggacctcgaacaggcggttcga
ctggcgaccgtcgcgggcgcggtctcgaccgaacgcgagggtgtacaggcggcggtgccg
tcgcgcaaggtagtcgaatcggcgaccgtgtga

DBGET integrated database retrieval system