KEGG   Halogeometricum borinquense: Hbor_37240Help
Entry
Hbor_37240        CDS       T01359                                 

Definition
(GenBank) Zn-dependent alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
hbo  Halogeometricum borinquense
Pathway
hbo00010  Glycolysis / Gluconeogenesis
hbo00071  Fatty acid degradation
hbo00350  Tyrosine metabolism
hbo00625  Chloroalkane and chloroalkene degradation
hbo00626  Naphthalene degradation
hbo01100  Metabolic pathways
hbo01110  Biosynthesis of secondary metabolites
hbo01120  Microbial metabolism in diverse environments
hbo01130  Biosynthesis of antibiotics
hbo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:hbo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Hbor_37240
  Lipid metabolism
   00071 Fatty acid degradation
    Hbor_37240
  Amino acid metabolism
   00350 Tyrosine metabolism
    Hbor_37240
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Hbor_37240
   00626 Naphthalene degradation
    Hbor_37240
Enzymes [BR:hbo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Hbor_37240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C ADH_zinc_N_2 ELFV_dehydrog TrkA_N Methyltransf_25 2-Hacid_dh_C Methyltransf_11
Motif
Other DBs
NCBI-ProteinID: ADQ69430
UniProt: E4NWL0
Position
pHBOR04:135643..136704
Genome map
AA seq 353 aa AA seqDB search
MRAAVLEEYGEPLSIEDVAAPDAAADGVVVELEACGICRSDWHAWQGDWDWLGLKPPKGQ
ILGHEPAGRVVGVGSDVETVREGDHVAIPFNLGDGTCPQCANGHGNTCENVVPLGFAEVA
QGAFAEQVHVPAADYNVVGLPEGVSSIDMAGLGCRFMTSFHALAHRADIEAGDWVAVHGC
GGVGLSAVHIADALGGNVVAVDLDDQKLELAEELGAAATVNANDAGSVPGAVRAIADDHV
GVSVDALGIPETCRNSIQSLGARGQHVQIGLTTEAEGGTIELPTDAMVMSEIEFIGSLGM
PPTKYDEIFRMVASGKLDPSAVVTDRVALDDVSETLAAMTNFETVGIPVIDEF
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgccgcagtgttagaggagtacggcgaaccgctcagtatcgaagacgtggctgca
cctgatgccgccgcggacggcgtggttgtcgaactggaggcctgtggcatctgccggagc
gactggcatgcatggcaaggcgactgggactggttaggtctcaaaccgccgaaaggccag
attctcggccacgagcccgccggacgcgtcgtcggagttggatctgacgtggagacggtc
cgcgagggtgaccacgttgcgattccgttcaatctcggtgacggaacctgtccgcagtgc
gctaacggccacggaaacacctgcgagaacgtcgtcccgctcggtttcgctgaggtagcg
cagggagcgttcgcagagcaggtacacgtcccggccgccgactacaacgtcgttggtctg
cccgagggcgtctcgtctatcgatatggccggtctcggttgccggttcatgacctcgttc
cacgcgctcgctcaccgcgcggacatcgaggcgggcgactgggttgccgtccacgggtgc
ggcggcgtcggtctctcggccgtccacatcgctgatgcactcggcggcaacgtcgtcgcc
gtggacctcgacgaccagaaactggaactggctgaagaactcggcgcggcggcgacggtg
aatgccaacgatgcggggagcgtccccggcgcagttcgtgctatcgcggacgaccacgtc
ggcgtctcggtcgatgcactcggtattccggaaacgtgccggaactccatacagagtctc
ggtgcacgtgggcaacacgtccagattgggctgacgaccgaagcggaaggcggtactatc
gaactacccacggacgcgatggtcatgagcgaaatcgagttcatcgggtcgttggggatg
ccgccgacgaagtacgacgaaatattccggatggtagcgagcggaaaactcgacccgagt
gccgtcgtcacggaccgtgttgcccttgacgacgtttccgagacacttgccgcgatgacg
aacttcgaaacggttggcatcccggttatcgacgaattctga

DBGET integrated database retrieval system