KEGG   Halogeometricum borinquense: Hbor_38190Help
Entry
Hbor_38190        CDS       T01359                                 

Definition
phosphodiesterase/alkaline phosphatase D
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
hbo  Halogeometricum borinquense
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:hbo00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:hbo00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:hbo02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pHBOR03:complement(15424..17526)
Genome map
AA seq 700 aa AA seqDB search
MAEDPSIDRDGSDHNRRTFLQAVGSSTVAAAGLSGTVSAESDGNEASSEQSDDDESNGET
PNNTQTIPLTHGVASGDVTATTAVVWARTADTATLQVQYSTDDEFDSTQRQTTTVADSTD
YTGHVRLTELQPATRYYYRVWATAGTSDESNEAVTSDGDTASVPDSTVEGTFVTPPKATD
DGAVTFAWSGDTWGYGPIPVDPPFEGLQTIAERQPDFFLYHGDTIYADAKTPAGRVTSDT
SLADALDIYRGKYKEMRVPPESVAEQTYLRSLLAATSVVSIWDDHEVQNNFAGSIEPLMP
SGRQAFIEYWPIDQSQQVTGTEASRLYRSFRWGAHLELFVLDTRQYRDPNLELKQKTLLG
REQLEWLKSSLSASDATWKVIASPAPLGQPSDTWATPTERTGYEAELVELISYINTEEIA
NVVSVAGDVHYSQVSGFDPNDDGEFEFYEAVAGPLGAYPSTPEELYSPLNPTAFFSKGGY
FNFGTVSVDESGDTLTIGIYDESGDEQFTKTIKATPASDGDVPERIESTFDDDAEGWLIA
QNGSSNTPEYYSEDGNPSGHIGDSEDKGGVTWYYQAPFKFLGPRDAFYGGTLAFDLRQEE
TDQQFDAALPVGGDIVLSGSGMTLVYEFRGDNSKPETDWTSFEVSLSADDDWINIDSQDP
FATEDEFRAVLSDLTQFRIRGEYRTGLDQSRLDNVVLTRE
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggaccctagcatcgacagagacggatcggaccataatcgccgtacctttctc
caagccgttggctcatcaacagttgcagccgccggcttatccggcacggtgagtgctgaa
tcggatggtaatgaagcaagtagcgaacagtcagacgacgatgagtcgaatggagagacg
ccgaacaacacgcaaaccatcccgctcacccacggcgtcgcgtcgggtgacgttaccgcg
acgactgctgtcgtgtgggcacgaacagccgacacggcgacactacaagtgcagtacagt
actgacgacgagttcgactcgacccaacgacaaaccacaacggttgccgactcgacagat
tacaccggacacgttcgactaacagaacttcagccggcgactcggtactattaccgcgtc
tgggcgacagccggaacgagcgacgagagtaatgaagcagtaacgtccgacggcgacacg
gcctctgtgccggattcgacagtcgagggaaccttcgtcaccccacccaaagcaaccgac
gacggggcagtcacgttcgcttggagcggtgatacgtgggggtatggacccattcccgta
gacccacccttcgagggcctccaaacgattgccgagcgacaaccagacttcttcctctat
cacggtgacaccatctatgcggacgccaagacgccggctggtcgggttacctcggacaca
tcacttgcggatgcgctcgacatctaccggggaaagtacaaggagatgcgtgtcccgcct
gagtcagtcgccgagcaaacgtatcttcgctccctgcttgcagcaacctcggtcgtcagc
atttgggacgatcacgaggtccagaacaactttgcgggctctatcgaaccgctgatgccg
tccggtcggcaggccttcatagagtactggccgatcgaccaaagccagcaggtgaccggg
acggaagccagtcgattgtaccgctcgttccgctggggagcccatctcgaactgttcgtt
ctggacacgcggcagtaccgcgatcccaatctcgaactgaaacagaaaacgttactcggt
cgtgagcaactggaatggttgaagagctctctgtcggcgtccgacgcgacatggaaggtg
atcgcctccccagcaccccttggccagccctccgatacgtgggcaacaccgacagagcgg
accggatacgaagcagaactggtggaactgatctcgtatatcaataccgaggagattgcc
aacgtcgtcagcgtcgctggcgacgtgcattactcgcaggtcagtgggttcgatcccaat
gacgacggcgagtttgaattctacgaggctgtcgccggcccacttggtgcgtacccgagt
acgccggaagaactctattcgccactcaatccgacagcattcttttcgaaaggcggatac
ttcaacttcgggacggtcagcgttgacgagtcgggagacacccttacgattggcatctac
gacgaaagcggcgacgaacagttcacaaagacgatcaaggcgacaccggcctccgacggc
gacgttcccgaacgcatcgagagtactttcgacgacgacgcggagggctggctaatcgct
caaaatgggagctccaacactcccgaatactactccgaggacggaaatcccagtggacat
attggtgatagcgaggacaagggcggggttacctggtactatcaagccccgttcaaattc
ctcggtccccgagacgcattctatgggggcacgctcgctttcgatctgcgccaagaagag
acggaccagcagttcgatgctgcccttccggtaggaggagacatcgttctcagcggttcg
gggatgacactcgtctacgaattccgtggcgacaactccaagcccgaaaccgactggacg
tcgttcgaagtgtcgctttcggcggacgacgactggatcaatatcgactcacaagacccg
ttcgccaccgaagatgagttccgtgcggtgctttcggacctcacacagttccgtatccga
ggtgagtatcgcactggactcgatcagagccgactcgacaacgtcgttctcacacgcgag
tga

DBGET integrated database retrieval system