KEGG   Hevea brasiliensis (rubber tree): 110669663Help
Entry
110669663         CDS       T05150                                 

Definition
(RefSeq) acid beta-fructofuranosidase 1, vacuolar-like isoform X1
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
hbr  Hevea brasiliensis (rubber tree)
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hbr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    110669663
   00500 Starch and sucrose metabolism
    110669663
Enzymes [BR:hbr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     110669663
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 693 aa AA seqDB search
MLSAFGELNWRASQPPIHAPIRLSPCSNLYTPNSNLHRDPPENTYMDYPNSIVAEASNTE
HAPYTPLQGQPSTVGPPTKLRRPLKVFSVTFASVIFLLSLVTLIINQSREPLQTPNKNPS
PSTPKATSFAKREPRGVAEGVSAKSNPSFFSDGVSYNWTNAMLAWQRTAYHFQPQRNWMN
DPDGPLFYMGWYHLFYQYNPDSAVWGNITWGHAVSRDLIHWFYLPFAMVPDQWYDTNGVW
TGSATLLPDGQIMMLYTGDTSDSVQVQNLAYPANLSDPLLIDWIKYPGNPVLVPPTGIET
DEFRDPTTGWVGPDGKWRITIGSRINETIGVSLVYQTTNFTTYELLEGFLHAVPGTGMWE
CVDFYPVAINGSQGLDTSANGPDIKHVLKASLDNTKVDYYALGTYDPVTDRWTPDNPKED
VGIGLRVDYGRYYASKTFYDQYKKRRILWGWINETDTEEDDLEKGWASVQTIPRAVLFDN
KTGTNLLQWPVEEIESLRLNSTDFEEVLVEPGSVVPLDIGMATQLDIFVEFETELISDSV
VEEYGCSGGAVDRSSLGPFGILAIADQTLSELTPVFFRPVNSTDGTLKTYFCADETRSSK
ALDVFKQVYGSTVPVLEDEKLGMRVLVDHSIVESFAQGGRTVITSRIYPTEAIYGAARLF
LFNNATSVNVKATLKIWELNSAFIRPFPFVDSN
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atgctgtccgccttcggagaacttaattggagagccagtcaaccaccaatccacgcaccc
atacgcctttcaccttgctctaatctctacactcccaactccaacctccatcgagatcca
cctgaaaatacgtacatggactatcccaactccattgttgccgaagcctccaatactgag
catgccccatacactcccttgcaggggcagccctccaccgtcggacctcccacaaaactc
cggcgacctttgaaagttttctctgtgacgtttgcctccgtcattttcttattgtcattg
gtgacattaatcattaaccaaagccgagagccattacaaacaccaaacaagaacccgtct
ccttcaacgcctaaagctacgtcatttgcgaaaagggagccaaggggcgtggccgaagga
gtatcagccaagtcaaatccatcatttttcagtgatggagtctcctacaattggacaaac
gctatgcttgcttggcaaagaacagcttaccatttccaaccccagcgaaattggatgaat
gatcctgatggtccattattctacatgggatggtaccatctattctaccaatacaaccct
gattcagctgtgtggggcaacatcacgtggggccatgctgtatcaagggacttgattcac
tggttttacctcccatttgcaatggtccctgatcagtggtatgatacaaacggcgtgtgg
actggctcggctactctccttccagatggtcaaatcatgatgctttacactggagacacc
agtgattcagtgcaggtgcaaaatctcgcgtacccggctaacctgtctgatccacttctc
attgactggatcaaatacccgggcaatccagttctggttcccccaacaggaattgaaacc
gacgaatttagggacccgacaacagggtgggttggacccgatggaaagtggcggatcact
atcgggtcaagaattaatgaaaccattggcgtttcacttgtgtatcaaaccaccaacttc
acaacctacgagctgttagaagggttcttacatgcggttccgggtacgggtatgtgggaa
tgtgtggacttttatccggttgcaataaacgggtcccagggattagatacatcagctaat
ggaccggatattaagcatgtgctaaaggctagtttggataatacaaaagtagattattat
gcactcggaacctatgacccagtaacagatagatggacacccgataacccgaaggaggat
gtgggtattgggttacgggtggactatggaaggtactacgcctcaaagacattttatgac
cagtacaagaaaaggaggattctatggggttggatcaatgaaactgacactgaagaagat
gacttggaaaagggctgggcctctgttcagaccattccaagggctgtattatttgacaat
aagactggaaccaatttgcttcaatggccagtggaggagattgagagcttgagattgaac
agtactgactttgaagaggttttggttgaacctggttcagtagtcccgctggacataggc
atggccacgcagctagacatttttgtggagtttgaaacagaattgatatcagattcggtg
gttgaagaatacggttgcagtggtggtgcagtagacaggagctctttgggaccatttggt
atcctggctattgcagaccaaacactttctgaactcacacctgtgtttttccgtcctgtc
aattcaactgacggcactctcaagacttatttctgtgctgacgaaacaagatcatcaaaa
gctcttgatgtctttaagcaagtttatggaagcactgttcctgtgctggaagatgaaaaa
ctaggcatgagggttctggtcgatcattcgattgtggaaagtttcgcacaaggaggaaga
acagtaatcacatcgcggatttatccaacagaagcaatctatggagctgcaaggctgttc
ttattcaacaacgcaacttctgtgaacgttaaagctacactcaagatatgggagttgaat
tctgcctttatccgtccgtttccatttgttgacagcaattaa

DBGET integrated database retrieval system