KEGG   Hyperthermus butylicus: Hbut_0051Help
Entry
Hbut_0051         CDS       T00468                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
hbu  Hyperthermus butylicus
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:hbu00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
41953..42891
Genome map
AA seq 312 aa AA seqDB search
MGIAELYLSRSSLLFGGVEVPLERAEAVIVGVPFDYTSSYRPGSRFAPRAIREAAANIEF
YSLRANLDVENIGISDLGDIAVSSQPLETLQRIEQVTRELLENMQDKLLIVLGGEHTITL
GVAKALAATREQPLCLIVFDAHLDLRQEYMGEKYSHASVMRRVVEQVTSNIFYIGARAFT
SEEFSYMRSHGLQMVTPQQARLLGLAEIVRRIRNWAKSSECKTLYISFDIDAYDPAYAPG
AANPEPDGLETWLALELLHRIIIEVPATIAVFDLVEVSPPYDCSWITSILAAKTVVEAIA
ANHVARRAARQP
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgggtatagctgaactatatctctcaaggagcagcctcctctttggcggcgttgaggtg
ccgctagagcgggctgaggcagttattgttggtgtaccatttgactatacgtcaagctac
cggcctggctcgcgctttgccccccgtgcgataagagaggcagctgcaaacatagaattc
tattcgctgagagcgaatcttgacgtggaaaatataggtataagcgatctaggcgacata
gcagtatcatcgcagccccttgaaacattgcagcgtatcgagcaggtgacaagagaactg
ctcgagaatatgcaagataagctgctaatagtgctcggtggtgaacatacaataacgctt
ggtgttgccaaggccctagcagctacaagggagcaaccactatgcctcatagtctttgat
gcccacctcgatctccgacaggagtacatgggcgagaaatactcgcatgctagtgtcatg
aggagagttgttgagcaagtaaccagcaacatattctacatcggtgccagagcatttaca
agcgaggagttttcgtatatgcgcagccacggcttacaaatggtaaccccacagcaagcc
cggctcctagggctagctgagatcgtacggagaatccgtaactgggctaaatccagtgag
tgcaaaacgctatacataagcttcgacatagacgcatacgaccctgcctatgcacccggc
gcagcaaatcccgaacctgacgggctggaaacttggcttgcactagaactcctacaccgt
atcataatcgaggtaccggcaaccattgcagtctttgacttagtagaggtctcaccaccc
tacgactgctcctggataacgagcatactagcagcaaaaacagtggtagaagccatagcc
gcaaaccatgtagcgcgccgagcagctagacagccttga

DBGET integrated database retrieval system