KEGG   Hyperthermus butylicus: Hbut_0126Help
Entry
Hbut_0126         CDS       T00468                                 

Definition
diaminopimelate aminotransferase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
hbu  Hyperthermus butylicus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hbu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Hbut_0126
  Amino acid metabolism
   00300 Lysine biosynthesis
    Hbut_0126
Enzymes [BR:hbu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Hbut_0126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
110606..111835
Genome map
AA seq 409 aa AA seqDB search
MRVLDETDARTLHSYIIDLYKSFIPVKAIPPDMGGEGELERAKVLEDELRRLGLRVWRVD
ARDERARGGIRPNILAQLEGADTSRTLWIVAHMDTVPEGDRSLWRYEPYSVTVEDDYVYG
RGVEDNGQAIVVAFAVAKYLVERGVKPRVNLGIALVSDEETGSRYGLQYLLSQNVFGTPE
SNWFLVPDAGSPDGSKVIVAEKHILWFKIRVVGMQAHASTPHEGINAHRLGMMFNLELDR
ILHTRFTRYDPIFEPPVSTFEPTRKEENVSNINTIPGVDTVYWDARILPSYSIDEVVETV
KSTAYSFASSHGIKVEVEIVARDDAGEPTSPDHPFTRAFLRAIREARNVEPKLLGIGGGT
IARYLRKKGYPALVWMTCEETAHKPNERARLSSILADVDTVLYYLLHVA
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
ttgcgggtactcgacgagactgatgccaggactctccacagctatattatagacctctac
aagagcttcataccagtaaaggccattccaccggatatgggtggcgagggcgagctagag
cgcgccaaggtactcgaggatgagcttagaagacttgggctgagggtttggcgcgtagat
gcgagggatgagagggctagaggtggcataaggcccaacatactcgcccagctcgagggc
gccgacacctctaggactctctggatagtagcccacatggacactgtgcctgagggtgac
cgtagtctctggaggtatgagccttacagcgtaaccgtcgaagatgactatgtatatggc
cgcggcgtggaggacaacggccaggcaatagtggtagcttttgcagtggccaagtacctg
gttgagaggggggttaagcccagggtaaaccttggcatcgcccttgtcagcgatgaggag
acaggtagtaggtacggtctacagtatcttctcagtcagaatgtattcggcactccggag
tccaactggttcctcgttcctgacgctggcagccccgatggcagcaaggttatagttgca
gaaaaacacatactatggttcaagatccgtgtcgtaggtatgcaggcccatgcaagcaca
ccacacgaggggattaacgcccatcggttgggtatgatgtttaacctggagcttgaccgg
atccttcacacaagatttaccaggtacgacccaatcttcgagcctcccgtctcaacattt
gagcctacaaggaaggaggagaatgtaagtaatattaacacgatacctggtgtagacacg
gtatactgggatgccaggatactgccaagctatagcatagacgaggttgtagagactgtt
aagtctacagcctacagctttgcctcaagccacggcataaaggtggaggtagaaattgtt
gcgagggatgacgctggcgaaccaacaagcccagaccatcccttcaccagagccttcctt
agagccataagagaggctaggaatgttgaaccgaaactactaggtattggcggcggcacg
atcgcgaggtacttgaggaagaaggggtaccccgctctcgtctggatgacatgtgaggag
acagcccacaagcccaacgagagggctaggcttagcagcatactagctgacgtggacact
gtactctattacctgctacacgttgcctag

DBGET integrated database retrieval system