KEGG   Hyperthermus butylicus: Hbut_0203Help
Entry
Hbut_0203         CDS       T00468                                 

Definition
succinyl-CoA synthetase beta chain (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
hbu  Hyperthermus butylicus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:hbu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Hbut_0203
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Hbut_0203
   00640 Propanoate metabolism
    Hbut_0203
   00660 C5-Branched dibasic acid metabolism
    Hbut_0203
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Hbut_0203
Enzymes [BR:hbu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Hbut_0203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(183750..184883)
Genome map
AA seq 377 aa AA seqDB search
MKLFEFEAKEILRKYGADVPPGVVIARGEDAREKILEAGLEPPLMVKSQVLVAGRGKAGG
IRRANSIDEAVRLVGELFETPIKGLKPRYILVEKAVEHEAELYTAITLDRSKRRPVVLVS
RYGGMDIEEIAREKPESIIRMHVDPVLGLRGYHARKLGKAIGLSGRALTSFAAFLQAMYQ
VFVDYDAELVESNPLGLVGDKVIPLDARIIVDDNALYRHQELAKDIEETGEYSEWEIKAR
RQGLAFVELDGDIGIIGNGAGLTMATMDLVYEHGGRPANFLDIGGGASAEAVKRAVLFLF
EYPKARKIFINIFGGITRCDEVARGVVEAIKEAGGLRKPIVIRLTGTNEEEGRRILREHG
IEAFDDPFEAVKRIISL
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
ttgaagctattcgagttcgaggcaaaggagattttgaggaagtatggtgccgatgtaccg
ccaggcgtcgttattgcccggggcgaggatgcccgggagaagatcctcgaggcggggctg
gagccgcctctcatggttaagagccaggttctcgtagctggccgcggcaaggctggcggc
ataaggagggccaattccatcgatgaggctgttaggctggttggggagctgtttgagacc
cctatcaaggggcttaagccacgctacatactggttgagaaggctgttgagcatgaggcg
gagctctacactgctatcacgcttgatcgtagcaagaggaggcctgtagtcctggtatcc
aggtacggcggcatggatattgaggagattgcgcgggagaaaccggagagcatcataaga
atgcacgttgaccccgtgctaggcctgcggggctaccacgctagaaagctgggcaaggct
ataggcctcagtggcagggcactgacgagctttgcagccttcctgcaggcaatgtaccag
gtattcgtggattatgacgcggaactcgtggagtctaacccgctgggcctcgtcggcgac
aaggtgatccctctcgacgcaaggataattgtcgacgataatgcgctctacaggcaccag
gagctagccaaggacatcgaagagaccggcgagtatagcgagtgggagataaaggctagg
aggcagggcctagcctttgtagagcttgacggcgacataggaatcatagggaacggtgca
ggcctaacaatggcaaccatggacctcgtatacgagcatggtggcagaccggcaaacttc
ctcgacataggcggtggcgcaagcgccgaggccgtgaagagggctgtgttgttcctcttc
gagtaccccaaggcaagaaagatattcataaacatcttcggcggaataacccgctgcgac
gaggttgctaggggcgttgtcgaagctatcaaggaggctggaggactgaggaagcccatt
gtgataaggctaacgggcaccaacgaggaggagggccgccgaatactcagggaacacggt
atagaagcttttgacgacccattcgaggctgtcaagcgcatcatatccctctag

DBGET integrated database retrieval system