KEGG   Hyperthermus butylicus: Hbut_0381Help
Entry
Hbut_0381         CDS       T00468                                 

Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
hbu  Hyperthermus butylicus
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hbu00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Hbut_0381
Enzymes [BR:hbu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Hbut_0381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(370391..371899)
Genome map
AA seq 502 aa AA seqDB search
MPVKGLKVEAASIDPGHDAVILNPRDAEHLGVVAGLRASVVCRGRGVGAVVIVDPRVPER
VAQLTKGLVERLGDCDTVDVHPIDVPPSFDAFKKRLSGARLSAAEYKMLIADIVAGYYDD
AQIASFLVSQLYSKLADEELEHLIRAMVETGEVVKFGEPVYDVHSIGGVPGNSKVALLVV
PIVASRGLLIPKTSSRAITSPAGTADTMEVLAKVAFKPQELHDMALRARGLIVWGGALNL
APADDIFVRVERRIGVDPPTQMVASILAKKLAMSVSRLVIDLPTGRGAKVQDESEAELLA
SMFLAQAGRLNIAMRVAITFGGEPIGFSVGPALEAREALQTLMKGDGASSLVEKACSLAG
LVFELGGVVPRGRGYSLACEILRSGAAYRKFREIIEVQEGDPDIKPEDIKLAPKQFTLEA
PRDGIVTMIDNRAISLAARAAGAPEDKGAGIQLHVKTGYRVRKGDPLLTIYASSDTRLHE
AVRLLDEYNAVLIEGVVVKVLP
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgccggttaagggcttaaaggttgaggcagcatcaatagatccgggtcacgatgctgtc
atcctaaacccccgtgatgctgagcatctcggtgtagtagccggcctgagagccagcgta
gtctgcaggggtagaggtgtcggagcagtagttattgttgatccccgggtccccgagcgt
gttgcacaactaaccaagggcctcgttgagagacttggtgactgcgatactgtggatgta
caccccattgatgtgccgccaagctttgatgcgtttaagaaaaggctctccggagctagg
ctatccgctgcagagtataagatgcttatagcagacatagttgcaggatactatgacgat
gcacagatagcctcgttcctagtaagccagctctacagcaagctagccgacgaggagcta
gagcacctcataagagccatggtggagactggcgaggttgtaaagtttggcgaaccagtt
tacgatgttcatagtataggtggtgtacccggaaacagcaaggttgcactcctggtcgta
cccatagttgcgtcgcgaggcctactcataccaaagactagtagcagggcgataacgagt
ccggcaggcacggcagacacgatggaggtcctcgctaaggtcgcgttcaagccacaagaa
ctgcatgatatggcgctaagagcccgtggcctcatagtctggggtggcgcgctaaacctc
gcaccggctgacgacatcttcgtaagggttgaacgcaggataggtgtggatccccctacc
cagatggttgccagtatactcgcgaagaagctggctatgagcgtgtcgagactggtgata
gacctccctacaggccggggcgctaaggtgcaggatgagagtgaggctgagctactagca
tctatgttccttgcccaggctgggaggctaaacatagcgatgagagttgcgataaccttt
ggtggcgaacccataggcttcagtgttggcccagcactagaagcacgggaagctctacaa
acactgatgaagggtgatggagcgtcaagcctggtggagaaggcttgcagcctagcaggc
ctagtctttgaactcggcggcgtagtgccacgcgggcggggctacagtctggcatgcgag
atacttcgcagcggtgcagcataccgcaagttccgcgagataatagaggttcaggagggt
gatcccgacataaagcctgaagacataaagttggcgcccaagcagttcactcttgaagct
ccgcgtgacggcatagtaacaatgatagacaaccgcgcaatatcgctcgcagctcgtgcg
gcaggagcacccgaggacaagggcgcaggcatacagctacacgtcaagacaggctaccgt
gtaaggaagggagaccccctgctaacgatatacgcttcaagcgatacaaggctccatgag
gcagtgagactcctagatgaatacaatgcagtacttatagagggagtcgtagtaaaagtc
ttaccatag

DBGET integrated database retrieval system