KEGG   Hyperthermus butylicus: Hbut_0381Help
Entry
Hbut_0381         CDS       T00468                                 

Definition
(RefSeq) thymidine phosphorylase
  KO
K18931  
AMP phosphorylase [EC:2.4.2.57]
Organism
hbu  Hyperthermus butylicus
Brite
Enzymes [BR:hbu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.57  AMP phosphorylase
     Hbut_0381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(370391..371899)
Genome map
AA seq 502 aa AA seqDB search
MPVKGLKVEAASIDPGHDAVILNPRDAEHLGVVAGLRASVVCRGRGVGAVVIVDPRVPER
VAQLTKGLVERLGDCDTVDVHPIDVPPSFDAFKKRLSGARLSAAEYKMLIADIVAGYYDD
AQIASFLVSQLYSKLADEELEHLIRAMVETGEVVKFGEPVYDVHSIGGVPGNSKVALLVV
PIVASRGLLIPKTSSRAITSPAGTADTMEVLAKVAFKPQELHDMALRARGLIVWGGALNL
APADDIFVRVERRIGVDPPTQMVASILAKKLAMSVSRLVIDLPTGRGAKVQDESEAELLA
SMFLAQAGRLNIAMRVAITFGGEPIGFSVGPALEAREALQTLMKGDGASSLVEKACSLAG
LVFELGGVVPRGRGYSLACEILRSGAAYRKFREIIEVQEGDPDIKPEDIKLAPKQFTLEA
PRDGIVTMIDNRAISLAARAAGAPEDKGAGIQLHVKTGYRVRKGDPLLTIYASSDTRLHE
AVRLLDEYNAVLIEGVVVKVLP
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgccggttaagggcttaaaggttgaggcagcatcaatagatccgggtcacgatgctgtc
atcctaaacccccgtgatgctgagcatctcggtgtagtagccggcctgagagccagcgta
gtctgcaggggtagaggtgtcggagcagtagttattgttgatccccgggtccccgagcgt
gttgcacaactaaccaagggcctcgttgagagacttggtgactgcgatactgtggatgta
caccccattgatgtgccgccaagctttgatgcgtttaagaaaaggctctccggagctagg
ctatccgctgcagagtataagatgcttatagcagacatagttgcaggatactatgacgat
gcacagatagcctcgttcctagtaagccagctctacagcaagctagccgacgaggagcta
gagcacctcataagagccatggtggagactggcgaggttgtaaagtttggcgaaccagtt
tacgatgttcatagtataggtggtgtacccggaaacagcaaggttgcactcctggtcgta
cccatagttgcgtcgcgaggcctactcataccaaagactagtagcagggcgataacgagt
ccggcaggcacggcagacacgatggaggtcctcgctaaggtcgcgttcaagccacaagaa
ctgcatgatatggcgctaagagcccgtggcctcatagtctggggtggcgcgctaaacctc
gcaccggctgacgacatcttcgtaagggttgaacgcaggataggtgtggatccccctacc
cagatggttgccagtatactcgcgaagaagctggctatgagcgtgtcgagactggtgata
gacctccctacaggccggggcgctaaggtgcaggatgagagtgaggctgagctactagca
tctatgttccttgcccaggctgggaggctaaacatagcgatgagagttgcgataaccttt
ggtggcgaacccataggcttcagtgttggcccagcactagaagcacgggaagctctacaa
acactgatgaagggtgatggagcgtcaagcctggtggagaaggcttgcagcctagcaggc
ctagtctttgaactcggcggcgtagtgccacgcgggcggggctacagtctggcatgcgag
atacttcgcagcggtgcagcataccgcaagttccgcgagataatagaggttcaggagggt
gatcccgacataaagcctgaagacataaagttggcgcccaagcagttcactcttgaagct
ccgcgtgacggcatagtaacaatgatagacaaccgcgcaatatcgctcgcagctcgtgcg
gcaggagcacccgaggacaagggcgcaggcatacagctacacgtcaagacaggctaccgt
gtaaggaagggagaccccctgctaacgatatacgcttcaagcgatacaaggctccatgag
gcagtgagactcctagatgaatacaatgcagtacttatagagggagtcgtagtaaaagtc
ttaccatag

DBGET integrated database retrieval system