KEGG   Hyperthermus butylicus: Hbut_0495Help
Entry
Hbut_0495         CDS       T00468                                 

Definition
(GenBank) NADPH glutamate synthase
  KO
K00266  glutamate synthase (NADPH/NADH) small chain [EC:1.4.1.13 1.4.1.14]
Organism
hbu  Hyperthermus butylicus
Pathway
hbu00250  Alanine, aspartate and glutamate metabolism
hbu00910  Nitrogen metabolism
hbu01100  Metabolic pathways
hbu01110  Biosynthesis of secondary metabolites
hbu01120  Microbial metabolism in diverse environments
hbu01130  Biosynthesis of antibiotics
hbu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hbu00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Hbut_0495
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Hbut_0495
Enzymes [BR:hbu01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.13  glutamate synthase (NADPH)
     Hbut_0495
    1.4.1.14  glutamate synthase (NADH)
     Hbut_0495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox NAD_binding_8 Pyr_redox_3 AlaDh_PNT_C HI0933_like DAO Shikimate_DH Thi4 FAD_binding_3 FAD_binding_2 FAD_oxidored UDPG_MGDP_dh_N TrkA_N ApbA GIDA 2-Hacid_dh_C Glu_dehyd_C NAD_binding_9
Motif
Other DBs
NCBI-ProteinID: ABM80357
UniProt: A2BK46
Position
complement(475757..476776)
Genome map
AA seq 339 aa AA seqDB search
MRFIVGCKPGQAEPRSERIAIIGAGPAGLYAAGYLRCRGFNVTVFDRNPEPGGFLIFGVL
EIHINKAKVREGIKELHELGVEFRQNITVCRDVSLEELINNYDAVLIATGTWESARLNIP
GANLEGIYPAMEWIVDYHMWKYGYKSEKPPIGERVVVIGGGLTAVDAVHVSKWLGAKEVY
MVYRRIRQYAPAGERGFREAEEAGAKIIELASPVEYIPDPSGKRVAAVKFERMKLVEQPG
SKRPKPVGTGEYFTIEADLVLEAIGLKPTPPCNVEQLGIKLRPDGTIDVDEYKRTTREPV
FAAGDVEHGASLIGIAMKGGLDAAKAIEKYLNREIGWRS
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
ttgagattcatcgtaggctgcaagcctggccaagcagagccacgcagcgagaggatagca
attatcggtgctggcccggccggcctctacgctgccggttacctacgttgtaggggcttc
aacgttactgtattcgataggaatcccgagcctggtggtttcctaatatttggcgtcctt
gagatacatattaacaaggctaaggtgcgtgaaggtattaaagagctgcatgagctaggc
gtagagtttaggcagaacatcacggtgtgtagagatgtctcgctcgaggagctaataaac
aactatgacgcggtactgatagcgactggcacctgggagagtgccagactaaacatcccg
ggcgcaaatcttgaaggcatatatccggctatggagtggatcgtagactaccacatgtgg
aagtacgggtataagagtgagaagccgccgataggcgaaagggtcgttgttataggtggc
ggcctcacagctgtagacgctgttcatgtctcaaagtggcttggagctaaggaggtctac
atggtgtatagacgtatacgccaatacgctcccgcgggtgaaagggggttcagggaagcc
gaagaagctggtgcgaagatcattgagctagcctcaccggtagagtacataccagatcca
agtggtaagcgtgttgccgcagtcaagtttgaaaggatgaagcttgttgagcaacccggc
tccaagaggcccaagcccgtgggtactggtgagtatttcacaatagaggcggacctcgtc
cttgaagccatagggctcaaaccaacaccaccatgcaatgtagagcagctgggcataaag
cttaggccggacggcacaatagatgttgacgagtacaagaggaccactagagagccagtg
ttcgctgctggcgacgttgaacacggtgctagtctgataggcattgcgatgaagggaggc
ctagacgctgccaaagcgatagagaagtatctcaacagggagataggctggaggagttag

DBGET integrated database retrieval system