KEGG   Hyperthermus butylicus: Hbut_0506Help
Entry
Hbut_0506         CDS       T00468                                 

Definition
(GenBank) hypothetical protein
  KO
K07732  
riboflavin kinase, archaea type [EC:2.7.1.161]
Organism
hbu  Hyperthermus butylicus
Pathway
Riboflavin metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hbu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Hbut_0506
Enzymes [BR:hbu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.161  CTP-dependent riboflavin kinase
     Hbut_0506
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
489015..489464
Genome map
AA seq 149 aa AA seqDB search
MENGAVQQLQLLGKRVKGFGVGGRYVAHPYYSGRFRELLGCTPFPGTLNFDANLDWRELA
SMCEPQVIPGTVWDGVRLGAVYVWKAKIMTRHGYVDCAVIRPLLSGHPPTVLEIVACEKL
EPILENNPDKTVIVTIACKRGDALRWRRY
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
ttggagaacggagctgtgcaacagttacagctgctcggaaagagggttaagggctttggt
gttggaggtcgctatgtggcgcatccctactactctggcagatttcgcgaactacttggc
tgcacaccattccccggcacgttgaactttgatgctaacttggattggcgcgaattagca
tcaatgtgtgagccccaggtcataccagggacggtatgggatggtgttaggcttggcgca
gtctatgtgtggaaggcgaagataatgactcgccatggctatgtggactgtgccgtgatc
aggccactgcttagcggtcaccccccgacagtattggagattgttgcatgtgaaaagcta
gagcctatactcgagaataacccggataaaacagtgatagtgacaattgcttgcaagcgg
ggcgatgcgctacggtggaggagatactag

DBGET integrated database retrieval system