KEGG   Hyperthermus butylicus: Hbut_0507Help
Entry
Hbut_0507         CDS       T00468                                 

Definition
(GenBank) Biotin synthase-related enzyme
  KO
K01012  biotin synthase [EC:2.8.1.6]
Organism
hbu  Hyperthermus butylicus
Pathway
hbu00780  Biotin metabolism
hbu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hbu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Hbut_0507
Enzymes [BR:hbu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.6  biotin synthase
     Hbut_0507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM SicP-binding
Motif
Other DBs
NCBI-ProteinID: ABM80369
UniProt: A2BK58
Position
489449..490450
Genome map
AA seq 333 aa AA seqDB search
MEEILVRASIGTLAALGLAGIRVAAKPTTAYLLQYSPYGCLAGCKFCTQSLRSPASKDML
SRVKWPVVRLTELLAAWRKAGRPFTRICIQTVVKPWFGCEAARILEAIRTIDQETPASIA
STPVSTRLLLYWKSLGVDYLGVGLDAVTPTVFRRAGKPFTWTSYMDFIERGIAVYGRGHV
YVHLIVGLGEKPTEIIRLMEKLYAMGARVALFNYTAVTSWKTSSVRIEDYRLLQLAREIL
EEGLDPWDYIEERNGSLVLRECPPVNLVKAVLTSGCPGCNRPFYNESPRGPIYNYPSPAL
AVRDREALKHQLLGRARGLERCIEGWVSQSSGS
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
gtggaggagatactagtccgagcctctataggcacccttgcagctctaggtcttgcaggg
atacgagtagctgcaaaacctacaaccgcctacttactccagtatagtccctacggctgc
ctcgccgggtgcaagttctgtacacagtctctacgctcgccagcaagtaaggatatgctt
tcaagagtaaaatggccagtagttaggctcactgagctactggcagcatggcggaaggca
ggtaggccatttacgagaatctgtattcagaccgttgtaaagccatggtttggttgcgaa
gctgcaagaattctcgaggccatacgaaccatagaccaagagacccctgcctctatagcc
tcaacacctgtatctacaaggctcctattgtactggaagagtctaggtgtggactatctc
ggcgtaggccttgatgctgttactccaacggtatttaggcgtgctggcaaaccattcaca
tggacaagctacatggactttattgagagaggtatagctgtctacggtcgcggtcacgta
tatgtacacttgatagttgggctcggcgaaaagcctacagagattataaggctcatggag
aagctctacgccatgggtgctcgtgtagcgctattcaactacacggctgtaacaagctgg
aagacaagcagcgtaagaatcgaggactaccggctgctccagctagcccgtgaaatcctt
gaagaaggcctagatccctgggactacatcgaggagaggaatggcagcctcgtgctccgc
gagtgccccccagtaaaccttgtaaaagctgtattgacgagcggttgtccaggctgcaat
agaccattctacaacgagagtccccgcggcccgatctacaactatccaagcccagcgcta
gctgtaagggatagggaggcactgaagcaccaactgctaggcagagctagagggctggag
aggtgtatcgaagggtgggtatcgcagtcttcaggctcatag

DBGET integrated database retrieval system