KEGG   Hyperthermus butylicus: Hbut_0529Help
Entry
Hbut_0529         CDS       T00468                                 

Definition
(GenBank) 30S ribosomal protein S11
  KO
K02948  small subunit ribosomal protein S11
Organism
hbu  Hyperthermus butylicus
Pathway
hbu03010  Ribosome
Module
hbu_M00179  Ribosome, archaea
Brite
KEGG Orthology (KO) [BR:hbu00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    Hbut_0529
Ribosome [BR:hbu03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    Hbut_0529
  Bacteria
    Hbut_0529
  Archaea
    Hbut_0529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S11 Pilus_CpaD
Motif
Other DBs
NCBI-ProteinID: ABM80389
UniProt: A2BK78
Position
512238..512639
Genome map
AA seq 133 aa AA seqDB search
MVFSAREIKWGVAHIYSSYNNTIIHITDLTGAETVARTSGGMVVKADREKPSPYAAMLAA
SRAAQQAMDRGIMALHIKVRAPGGHGPKTPGPGAQAAIRALARAGFIIGRIEDVTPLPHD
TTRRPGGRRGRRV
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
gtggtgttctcggctcgcgagattaagtggggtgtagcccacatatactcgagctacaac
aacacgataatacacatcacagacctcaccggcgccgagaccgtagctaggactagtggc
ggcatggtcgtgaaggctgaccgcgagaagccaagcccctacgccgcaatgctagctgcc
agtcgtgcagcacagcaggccatggataggggtataatggcgcttcacatcaaggttaga
gcccctggaggccacggccccaagacgccaggcccgggtgcacaggcagcaatacgtgct
ctagcaagagcaggcttcataataggccgcattgaggacgtgacgccactgccccacgac
acaacgagaaggcctggcggtaggaggggtcgccgcgtctag

DBGET integrated database retrieval system