KEGG   Hyperthermus butylicus: Hbut_0562Help
Entry
Hbut_0562         CDS       T00468                                 

Definition
(GenBank) uncharacterized protein, putative amidase
Organism
hbu  Hyperthermus butylicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Creatininase
Motif
Other DBs
NCBI-ProteinID: ABM80422
UniProt: A2BKB1
Position
complement(536084..536818)
Genome map
AA seq 244 aa AA seqDB search
MARVCSPYSSNAYCRASVALLPVASVENHGVLPLASDVLIADCVVQRVKTSVEGADGIAI
LPVIPYSVCVEHEPPRLGVRPSVFIEYLVDLLNEILAYTGSVVIAVFHGGAFHAAYIAAR
YARRTTGRPVLVYSFWQVVEDTLQKRYGLKPGILHADPVEASILLACGYKGSWLKEENID
TVLSILHSSNHRTPIQPWIAEDVPGLYPDQPVPASQELGETLLEEAVAELISTIKTTAKK
PPGG
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
ttggcacgggtttgtagcccctatagcagcaacgcatattgcagggcgtccgttgcgcta
ctccccgtcgcctccgtcgaaaaccatggcgttctcccgttagcatccgacgtcctgatc
gccgactgcgtagtacagcgcgtcaagacctcagtagagggggccgacggtattgctatt
ctaccagtcatcccatactctgtctgcgtggagcacgagcccccgcggctcggtgtgcgt
cccagcgtgttcatagagtacctcgtagacctactaaacgagatcctagcatacacggga
tcagtcgtcatagctgtgtttcatggtggtgccttccacgcagcctacatcgccgccaga
tacgctaggaggacaactgggagacccgtgctagtctacagcttctggcaggtagtagag
gatacactacagaaacgctacgggctcaagccaggcatacttcacgccgaccccgtcgag
gcaagcatactgctagcctgcggctacaagggatcctggctgaaggaagagaacatagac
accgtactgagcatcctccacagctcaaaccacagaacacccatccagccatggatagcc
gaggacgtcccaggactgtacccagaccagccagtgccagcgtcacaagagctgggcgag
acacttctggaggaggccgtagcagagctaatctcaacaattaaaactacagccaagaaa
cctcccggggggtag

DBGET integrated database retrieval system