KEGG   Hyperthermus butylicus: Hbut_0563Help
Entry
Hbut_0563         CDS       T00468                                 

Definition
(GenBank) conserved archaeal protein
Organism
hbu  Hyperthermus butylicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RHH_1 CcdA Imm70 Med28
Motif
Other DBs
NCBI-ProteinID: ABM80423
UniProt: A2BKB2
Position
536954..537166
Genome map
AA seq 70 aa AA seqDB search
MSAKIRRELKEEAERLGIDFSEVIRRAIEEEVKRRKLQLLREKLNGLRGALEKIDVEEIV
ELIRRDREER
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgctaagatacgccgcgaacttaaagaggaggccgaaaggctcggtatagacttc
tctgaggttataagaagggctatagaggaggaggttaagcggaggaagctccagctactt
cgtgagaagcttaacggtctgagaggcgccctggaaaaaattgatgttgaagaaattgtg
gagctaattaggagggatcgtgaggaacgttag

DBGET integrated database retrieval system