KEGG   Hyperthermus butylicus: Hbut_0571Help
Entry
Hbut_0571         CDS       T00468                                 

Definition
(GenBank) ribonuclease PH
  KO
K11600  
exosome complex component RRP41
Organism
hbu  Hyperthermus butylicus
Pathway
RNA degradation
Module
Exosome, archaea
Brite
KEGG Orthology (KO) [BR:hbu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Hbut_0571
Messenger RNA biogenesis [BR:hbu03019]
 Eukaryotic Type
  mRNA degradation factors
   3'-5' decay
    Core exosome factors
     Hbut_0571
 Prokaryotic Type
  Archeal mRNA degradation factors
   Exosome components
    Cofactors
     Hbut_0571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
542965..543732
Genome map
AA seq 255 aa AA seqDB search
MAGGAGEKPTLIRWEERDGQKVAIRHDGRLPEQLRPIRMEVGVLSNADGSALVEYGGTRV
IAAVYGPREAHPRHVALPDRAIIRCRYHMAPFSTAERKTPAPTRREVELSKVIREALEAV
VISELYPRTAIDVYMEVLQSDGGTRTAAITAASLALADAGIAMRDLVAGVAVGKVDGVLV
LDIDEIEDNYAEADMPVAMAPSLDKVLLLQLNGVLTHDEFVKALELARKGIQVIYNLQKE
ALRKKYVEVSVEEGA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggctggcggtgccggtgagaaacccacccttataaggtgggaggagcgggacggccag
aaagtagctatccgccatgatggtaggctgccggagcagctccgccccataaggatggag
gttggtgtcctcagcaatgctgatggctcggcgctagtagagtacggaggcaccagggtt
atagcagccgtctatgggcctcgtgaagctcatcccagacatgtagcgctgccagaccgt
gccatcataaggtgccgctaccacatggccccgttctcgacggctgaaaggaagacgcca
gcaccgacaaggcgcgaggttgaactatcaaaggttattcgtgaggcgttggaggctgtt
gttatctccgagctatatcctcgcacagccatcgatgtctacatggaggtgttgcagtcc
gatggcggcacgaggactgctgcgataacagctgcaagcctagcgctagctgatgcaggt
atagctatgagggatctcgttgctggtgttgcagtggggaaagttgatggagtcctggta
ctcgatatagacgaaatcgaggataactatgcagaggcagacatgccggtagcaatggcg
ccgagcctggataaggttctactcctacagcttaacggtgttctaacccatgacgagttt
gtaaaggcgctagagcttgcccggaagggtatacaagtgatctacaacctccagaaggag
gctctccgcaagaagtatgtcgaggtaagtgttgaggagggtgcataa

DBGET integrated database retrieval system