KEGG   Hyperthermus butylicus: Hbut_0582Help
Entry
Hbut_0582         CDS       T00468                                 

Definition
(GenBank) predicted ATPase
  KO
K06915  uncharacterized protein
Organism
hbu  Hyperthermus butylicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF87 TrwB_AAD_bind ArgK AAA_10 AAA_22 MobB FtsK_SpoIIIE AAA_16 ResIII DUF815 DUF853 AAA_30 RNA_helicase CpXC
Motif
Other DBs
NCBI-ProteinID: ABM80442
UniProt: A2BKD1
Position
complement(550851..552416)
Genome map
AA seq 521 aa AA seqDB search
MALPLARMGEEVGIVLSGASVAFAPIALRRDRELEVREEDLVVIYDHRLEDYYMLGVVRW
ITRYEPFLRRSIHNIYIEHPDALSIETVMPFTNAYVEIYGAICLNGKLCSSGQGFQSNIY
APTPGSRVFRLTNAEPLTEFLTVSSPVFVGRHKYSGWRLPLDTAWINYHVGVFGATGTGK
SRLVAKLIQELISAGYKLIIFDHSGVDYVPLAKKLGIPVISASSVRIEPQILASIVTRMM
GSLQSTQRDAVEVAAMCYAASAYGYNSSGQGRGAAIASECQQLTTGSVYRQKRLTQPSSQ
AGSNASGFDEFLGILGVVGQAFNLKTPTLAKLRLLARFSLPPELFDSLKTRGYEPRDIVE
KALSSGAVVLDASDERDIEVKRGILASIASAVWEIISERREPINLGLVVDEAQNYACEHC
GASSYALETIAREGRKWRFFIIVASQRITRDIKTSIRSNLGTVFFSKLQATGDLQELAGY
LDLGKVTEASLAMLGRREFYVAGLMNPLRRPMLLRVDEVQI
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
ttggctctaccactagcgcggatgggcgaggaggtaggtatagtacttagtggagccagc
gtagcattcgcgccaatagcactgcgcagggatcgtgagcttgaggtacgcgaggaggac
ctggtagtcatctatgaccacagactagaagactactatatgctcggtgtggttaggtgg
ataacccggtatgagcccttcctccggaggagcatccacaacatctacatagagcatccc
gacgcattgagcattgagaccgttatgcctttcaccaacgcatacgtggaaatctacggc
gccatatgcctaaacggtaagctgtgcagttctggccagggcttccagagcaatatctat
gcgcccacgccgggtagcagggtgtttaggcttactaacgcggagcccctcacagagttt
ctcactgttagcagcccagtgttcgtgggcaggcacaagtatagcgggtggagactcccc
cttgacaccgcctggataaactaccacgtaggtgtcttcggagctactggtacgggcaag
agccggcttgtagccaagctaatccaggaactaattagtgcaggctataaactcataatc
ttcgaccacagcggtgtggactatgtgcctctagccaagaagctcgggataccagtgata
agcgctagtagcgtgaggatagagccccagatactagcatcaatagtcacaaggatgatg
gggagcctacagagcacccagagggatgccgtggaagtcgcggctatgtgctatgcagcc
tcagcctatggctacaacagctctggacagggcagaggagccgccatcgcgtcagagtgt
cagcagctcacaaccgggtcagtataccggcagaaaagactaacacagcctagcagccaa
gctggcagcaatgctagcgggttcgacgagttcctaggcatactcggtgttgtaggccaa
gcctttaacctcaagacgccaacgctagccaagctaaggctactagcccggttctccttg
ccgccagagctcttcgacagtctcaagacgaggggttatgagcctcgggatatcgttgag
aaggcgttgtcgtctggcgcggtggtcctcgatgcaagtgatgagagggatattgaggtt
aagaggggcatactagcctcaatagcatctgcagtgtgggagatcatctctgagcggcgg
gagccgataaacctcggcctggtcgtggatgaggctcagaactacgcgtgcgaacactgt
ggagcttccagctacgcgttggagaccatagcgagggaggggaggaagtggaggttcttc
ataatcgttgctagccagagaataacgagagatatcaagacgagtatccggagcaatctc
ggcacggtattcttctcgaagctccaggctacgggcgacctgcaggagctagcaggctac
ctggatcttggcaaggttacggaggctagccttgcaatgctgggtaggagagagttctac
gtggccggcctcatgaatccgctgcggcgcccaatgctgctacgagttgacgaggtacag
atttag

DBGET integrated database retrieval system