KEGG   Hyperthermus butylicus: Hbut_0588Help
Entry
Hbut_0588         CDS       T00468                                 

Definition
(GenBank) predicted Co/Zn/Cd cation transporter
Organism
hbu  Hyperthermus butylicus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cation_efflux ZT_dimer
Motif
Other DBs
NCBI-ProteinID: ABM80448
UniProt: A2BKD7
Position
556823..557941
Genome map
AA seq 372 aa AA seqDB search
MVRRLAVRKILRARRAIRGVLVVATISLILSLLGLVMYVFYVPSEVILMEAFVWLIEALS
FGSLALAFKIAASKTVTYRARYELLRLEALAALITSVVAMFVTSTIMYKAVTAEHREPSP
IIVSVYPLGSGIMSFILEHRLSRILRGMRIKLVSVRMIAEKLKLDVVFELGGGVAIIAAN
LLNSALYETVAALVMSVYVLMGLYGIAREAAMHLLGLVPKSVHRDMEAKVRALLHKVTRY
RRIRRLKLESYGTFSEVELWLEAPSSISLGEAYYESIRIARELIHNIPELLRALVVLVPE
KEATSQLAMRLSEEVPRTRLGRRRRQVRLSSSRSVSRSLRGSVQSLQPRQVPRRVQSQQQ
RSGDGESQASSP
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggttaggaggcttgcagtaagaaaaattctgagagcacgtagggctattcgcggagta
ctcgtagtggctaccatatcgctaatcttgtccctactaggccttgtaatgtatgtcttc
tatgtgccgtcggaagtaattctgatggaggcctttgtatggcttatagaggctttatca
tttggtagtcttgccctagccttcaagatagctgcatcgaaaacagttacgtatcgtgca
cgatacgagctgttgaggcttgaagcacttgctgcgctgataacgagtgtagttgctatg
tttgtcacgtcaacaatcatgtataaggctgtaacagcagagcacagggagccttcacca
ataatagtgtcggtataccctttgggcagcggtatcatgagcttcatactcgagcacagg
ctgtcaaggatactgcgtggtatgcgcattaaacttgtaagcgttaggatgattgctgag
aagctaaagctagacgtagtatttgagctgggtggcggcgtagcaataatagctgcaaac
ctgctaaactcggcactatatgagactgttgcagcactagtaatgagcgtctatgtgctc
atgggtctttatggtatagctagagaggcagcaatgcatctcctaggccttgtgccaaag
agcgttcaccgcgacatggaggcaaaggttagagcgttactgcataaggttacacggtac
cgtaggattagaaggctaaagctggaaagctacggtacatttagcgaggtggaactctgg
ctagaggcgccatcatcaataagtcttggcgaggcatactatgaatcgataaggatagcg
cgtgagctaatacataacattccagaactgttgcgtgcacttgttgtccttgtcccagag
aaagaggccacaagccagctagcaatgaggcttagcgaggaggtgccaagaacgagactt
ggtagacgacgtcgtcaagtcagactttcctcttctcgatcagtttcgcgatctttgaga
ggtagcgtgcagtccttacagcctcggcaggtacctcgacgagttcagagccaacaacaa
cgaagtggcgacggcgaatcccaagcttcatcaccttaa

DBGET integrated database retrieval system